Align 1-phosphofructokinase (EC 2.7.1.56) (characterized)
to candidate WP_037571123.1 BS73_RS09750 1-phosphofructokinase family hexose kinase
Query= reanno::psRCH2:GFF3290 (312 letters) >NCBI__GCF_000744815.1:WP_037571123.1 Length = 305 Score = 160 bits (405), Expect = 4e-44 Identities = 110/308 (35%), Positives = 151/308 (49%), Gaps = 5/308 (1%) Query: 4 VLTVTLNPALDLTVQLPALRLGEVNRSDSLQVHAAGKGLNVAQVLADLGHQLTVTGFLGE 63 +LTVT N ALD++ LP LR GE NR S++ A GKG+NVA+VL LG + G G Sbjct: 2 ILTVTPNAALDVSYHLPELRPGEENRVRSVRERAGGKGVNVARVLHALGEPVLAAGLAGG 61 Query: 64 GNPQAFEQLFSARGFTDEFVRVAGETRSNLKLAEAD-GRVTDINGPGLAVSEAQRAELLA 122 + +A G + V E+R + + + G T + PG V+ + A Sbjct: 62 LTGRRIRDELAASGVPEALTEVTAESRRTVAVVATERGEATGLWEPGAEVAAGEWTRFRA 121 Query: 123 RLKRLVPAHELVVVAGSLPRGIDSQWFVQLLNSLKALGVRVALDTSGAALRDGLATRPWL 182 + L+ V + GSLP G + QL +A GV LD G AL GLA P L Sbjct: 122 AYRELLARTRAVALCGSLPPGAPGDAYAQLGADARAAGVPWLLDADGEALAAGLAAGPDL 181 Query: 183 IKPNEEELAEARGIELSGSSALAAEAQRLQEEGIEHVVVSQGADGVSWFSPGAALHASPP 242 +KPN EL G G LA A+RL G VVVS GA+G+ +P A A+PP Sbjct: 182 VKPNAAELRRVAG---DGDGELAG-AERLLALGARAVVVSLGAEGMLAVTPEGAWRAAPP 237 Query: 243 KVRVVSTVGAGDSLLAGMLHGLLEGWPAERTLTHATAIAAQAVGQVGFGITDTAQLAELQ 302 +V + GAGD+ +A + G+ G P + + A A++A AV G D EL+ Sbjct: 238 RVVHGNATGAGDAAVAALSRGVARGLPWQDRVRDAVALSAAAVASPVAGGYDAGVYEELR 297 Query: 303 AAVRLQPL 310 VR+ PL Sbjct: 298 PRVRVDPL 305 Lambda K H 0.316 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 305 Length adjustment: 27 Effective length of query: 285 Effective length of database: 278 Effective search space: 79230 Effective search space used: 79230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory