Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate WP_037573742.1 BS73_RS17935 class II fructose-bisphosphate aldolase
Query= BRENDA::I3EBM6 (285 letters) >NCBI__GCF_000744815.1:WP_037573742.1 Length = 288 Score = 174 bits (442), Expect = 2e-48 Identities = 104/275 (37%), Positives = 155/275 (56%), Gaps = 8/275 (2%) Query: 1 MPLVSMTEMLNKAKAEGYAVGQFNLNNLEFTQAILLAAEEEKSPVILGVSEGAGRYMGGF 60 M L + E++ A+A+G + FN+ LE +AI AE SP +L +S+ A R+ G Sbjct: 1 MTLATTGELVAAARADGRGLPAFNVITLEHAEAIAAGAEAAGSPAVLQISQNAVRFHGDR 60 Query: 61 KTVVNMVKGLMEDYKITVPVAIHLDHGSSFEKCKEVIDAGFTSVMIDASHHPFEENVEVT 120 + + + VP+A+HLDH + +AGF+S M DAS ++ NV T Sbjct: 61 LLPLARAAAAVAE-SAEVPLALHLDHVEDAGLLRSSAEAGFSSAMFDASALLYDGNVAAT 119 Query: 121 KKVVEYAHARGVSVEAELGTVGGQEDDVIADGVIYADPKECEELVKRTGIDCLAPALGSV 180 ++ ++AH +G+ +EAELG VGG+ D GV DP E V TG+D LA A+GS Sbjct: 120 REAADWAHRQGLWLEAELGRVGGKPGDAHTPGV-RTDPAEAAAYVAATGVDALAVAVGSS 178 Query: 181 HGPYKGEPNLGFKEMEEIGRITG---VPLVLHGGTGIPTKDIQRAISLGTAKINVNTENQ 237 H + L + E IGR+ VPLVLHG +G+P +++ A++ G KIN+ T Sbjct: 179 HAMTERTAVL---DRELIGRLRAAVPVPLVLHGSSGVPDEELTGAVAAGMTKINIGTALN 235 Query: 238 IASAKKVREVLAENPNMYDPRKYLGPARDAIKETV 272 A + +VR LAE+P++ DPR+YL P RDA+ +TV Sbjct: 236 TAFSAEVRAYLAEHPSVVDPRRYLAPGRDAMADTV 270 Lambda K H 0.314 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 288 Length adjustment: 26 Effective length of query: 259 Effective length of database: 262 Effective search space: 67858 Effective search space used: 67858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory