Align LacK, component of Lactose porter (characterized)
to candidate WP_037573817.1 BS73_RS18100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_000744815.1:WP_037573817.1 Length = 369 Score = 314 bits (805), Expect = 2e-90 Identities = 180/360 (50%), Positives = 228/360 (63%), Gaps = 19/360 (5%) Query: 14 GSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGELTIGGTVMNDVDPS 73 G + ++LE++ GEF+V VGPSGCGKST LRM+AGLED+++G + IG + + P Sbjct: 16 GDKPAVDALDLEIADGEFLVLVGPSGCGKSTSLRMLAGLEDVNNGAIRIGERDVTHLPPK 75 Query: 74 KRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAKILELDALMDRKPKA 133 R IAMVFQ YALYPHMTV +NMGFAL+ AG+ K EI +V AAKIL+L +DRKPKA Sbjct: 76 DRDIAMVFQNYALYPHMTVADNMGFALKIAGVNKAEIRSKVEEAAKILDLTEFLDRKPKA 135 Query: 134 LSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARLHKELNATIVYVTHD 193 LSGGQRQRVA+GRAIVR+P VFL DEPLSNLDA+LRV R +IA L + L T VYVTHD Sbjct: 136 LSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIAGLQRRLGITTVYVTHD 195 Query: 194 QVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRMNFLPA-VVIGQAEG 252 QVEAMT+ D++ V++ G+++QV P +YD P N+FVAGFIGSP MN + + G + Sbjct: 196 QVEAMTMGDRVAVLKDGLLQQVDTPRNMYDRPANLFVAGFIGSPAMNLVEVPITDGGVKF 255 Query: 253 GQVTVALKARPDTQLTVACATPPQGGDAVTVGVRPEHF-----LPAGSGDTQLTAHVDVV 307 G+ V + + A G VTVGVRPEH G D L V+VV Sbjct: 256 GESVVQVSRDAVGEAANA------GDKTVTVGVRPEHLDIVGGTEGGGEDKGLAVTVNVV 309 Query: 308 EHLGNTSYVYAHTVPGEQIIIEQEERRHGGR----YGDEIAVGISAKTSFLFDAS-GRRI 362 E LG YVY G + I R GGR GD++ V A + +F S G+R+ Sbjct: 310 EELGADGYVYGSAKVGTETI--DLVVRVGGRDIPMKGDQLRVVPRAGETHVFSTSTGKRL 367 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 369 Length adjustment: 30 Effective length of query: 333 Effective length of database: 339 Effective search space: 112887 Effective search space used: 112887 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory