Align N-acetylglucosamine kinase (EC 2.7.1.59) (characterized)
to candidate WP_051941195.1 BS73_RS31220 ROK family protein
Query= metacyc::MONOMER-19002 (326 letters) >NCBI__GCF_000744815.1:WP_051941195.1 Length = 362 Score = 178 bits (451), Expect = 2e-49 Identities = 112/332 (33%), Positives = 170/332 (51%), Gaps = 27/332 (8%) Query: 10 VVGIDIGGTNTVFGIVDARGTIIASGAVKTQVYPTVEEYADEVCKNLLPL---IIANGGV 66 V+ +DIGGT G+V G +++ V T+V +E + L L + G Sbjct: 20 VLALDIGGTKLAAGVVRDDGAVLSFRTVPTRV----QEGPEAALARLFTLGREALRAAGA 75 Query: 67 DKIK--------------GIGIGAPNGNYYTGTIEFAPNLPWKGVLPLASMFEERLGIPT 112 D GIG G P + TGT+ P+LP +P+A + G+P Sbjct: 76 DAADPADTAGPYGSLLGCGIGCGGPLDSA-TGTLIAPPHLPGWLDIPIAGLARREYGLPA 134 Query: 113 ALTNDANAAAVGEMTYGAARGMKDFIMITLGTGVGSGIVINGQVVYGHDGFAGELGHVIV 172 L ND A A GE +GA RG + + +T+ TG+G G+VI+G+ G G GE GH+ V Sbjct: 135 VLDNDGTAGAAGEWRFGAGRGTRHLVYLTVSTGIGGGVVIDGRTYRGAAGNGGEPGHITV 194 Query: 173 RRDGRIC-GCGRKGCLETYCSATGVARTAREFLAARTDA---SLLRNIPAESIVSKDVYD 228 R GR C CGR+GCLE Y S T +A ARE + T A + L PAE + + DV Sbjct: 195 RTGGRPCRSCGRRGCLEAYASGTSIAERAREAVREETAAGHWTALAEHPAEELGAADVAR 254 Query: 229 AAVQGDKLAQEIFEFTGNILGEALADAIAFSSPEAIILFGGLAKSGDYIMKPIMKAMENN 288 AA+ GD LA ++ T +LG+ L + PE ++L GG+ +SGD ++ P+ +++ Sbjct: 255 AALDGDALAVRLWRETTELLGDGLTSIVNLYEPEVLVLGGGVTRSGDQLLLPVRESVARQ 314 Query: 289 LLNIYKGKAKLLVSELKDSDAAVLGASALAWE 320 + +++++ D A VLGA+A+A+E Sbjct: 315 AMAPAAAACRVVLATGGDR-AGVLGAAAIAFE 345 Lambda K H 0.318 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 362 Length adjustment: 29 Effective length of query: 297 Effective length of database: 333 Effective search space: 98901 Effective search space used: 98901 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory