Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate WP_084703891.1 BS73_RS07930 ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >NCBI__GCF_000744815.1:WP_084703891.1 Length = 389 Score = 231 bits (589), Expect = 3e-65 Identities = 143/377 (37%), Positives = 211/377 (55%), Gaps = 17/377 (4%) Query: 3 DAIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLL 62 DA P P A+ P + ++T +Y Q ++ +L + GE+ ALLG SG GK+T L Sbjct: 20 DAGPAPAARR-----PGISFEDVTVAYRDQVVLNGFTLDVAAGEVVALLGPSGSGKTTAL 74 Query: 63 RMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLP 122 R +AGF P G++ + G D++ +PP+ R I M+ Q YALFPH+ VEQN+AFGLK + P Sbjct: 75 RTVAGFTAPVRGRVGIGGRDVTGLPPHRRGIGMVVQQYALFPHLRVEQNVAFGLKAHRTP 134 Query: 123 KAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDK 182 +A++ RV E L + M +A+R P +LSGGQ+QRVALAR+LA RP++LLLDEP+ ALD Sbjct: 135 RAQVPGRVAEALEMTGMAGYARRYPRELSGGQQQRVALARALAIRPEVLLLDEPLSALDA 194 Query: 183 KLRDRMQLEVVDI-LERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHP 241 LR M E+ + E V+ + VTHDQ EA+T+A RIA++ + V G PE +Y P Sbjct: 195 GLRAGMLAELARLHRELPEVSILYVTHDQIEALTLADRIAVLRDARLVDCGTPERLYRRP 254 Query: 242 TTRYSAEFIGSVN---VFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALR 298 ++A F+G N V G +R G G V L++ A P + +R Sbjct: 255 ADAFTASFVGRANLLPVTAGQEPDRVVLGAATHRTGAVE-LRITAQDGFPAGSPALLCVR 313 Query: 299 PEKIMLCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPT 358 P ++ E G N G V + +LG V L +G ++A+L + P Sbjct: 314 PHQLRPATE---GGPNLLRGRVSDVQWLGSTHRVQVDLDAGPRVAAELSGL----RVPPA 366 Query: 359 WGDEVRLCWEVDSCVVL 375 G+E+ L ++ + V+L Sbjct: 367 AGEELALGFDPEDGVLL 383 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 389 Length adjustment: 30 Effective length of query: 347 Effective length of database: 359 Effective search space: 124573 Effective search space used: 124573 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory