Align Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized)
to candidate WP_037573817.1 BS73_RS18100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= SwissProt::P9WQI3 (393 letters) >NCBI__GCF_000744815.1:WP_037573817.1 Length = 369 Score = 352 bits (902), Expect = e-101 Identities = 190/322 (59%), Positives = 226/322 (70%), Gaps = 4/322 (1%) Query: 1 MAEIVLDHVNKSYPDGHT-AVRDLNLTIADGEFLILVGPSGCGKTTTLNMIAGLEDISSG 59 MA + D + YP G AV L+L IADGEFL+LVGPSGCGK+T+L M+AGLED+++G Sbjct: 1 MATVTYDKATRIYPGGDKPAVDALDLEIADGEFLVLVGPSGCGKSTSLRMLAGLEDVNNG 60 Query: 60 ELRIAGERVNEKAPKDRDIAMVFQSYALYPHMTVRQNIAFPLTLAKMRKADIAQKVSETA 119 +RI V PKDRDIAMVFQ+YALYPHMTV N+ F L +A + KA+I KV E A Sbjct: 61 AIRIGERDVTHLPPKDRDIAMVFQNYALYPHMTVADNMGFALKIAGVNKAEIRSKVEEAA 120 Query: 120 KILDLTNLLDRKPSQLSGGQRQRVAMGRAIVRHPKAFLMDEPLSNLDAKLRVQMRGEIAQ 179 KILDLT LDRKP LSGGQRQRVAMGRAIVR P+ FLMDEPLSNLDAKLRV R +IA Sbjct: 121 KILDLTEFLDRKPKALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIAG 180 Query: 180 LQRRLGTTTVYVTHDQTEAMTLGDRVVVMYGGIAQQIGTPEELYERPANLFVAGFIGSPA 239 LQRRLG TTVYVTHDQ EAMT+GDRV V+ G+ QQ+ TP +Y+RPANLFVAGFIGSPA Sbjct: 181 LQRRLGITTVYVTHDQVEAMTMGDRVAVLKDGLLQQVDTPRNMYDRPANLFVAGFIGSPA 240 Query: 240 MNFFPARLTAIGLTLPFGEVTLAPEVQGVIAAHPKPENVIVGVRPEHIQDAALIDAYQRI 299 MN +T G+ V ++ + G AA+ + V VGVRPEH+ + Sbjct: 241 MNLVEVPITDGGVKFGESVVQVSRDAVGE-AANAGDKTVTVGVRPEHLDIVGGTEGGGED 299 Query: 300 RALTFQVKVNLVESLGADKYLY 321 + L V VN+VE LGAD Y+Y Sbjct: 300 KGLA--VTVNVVEELGADGYVY 319 Lambda K H 0.319 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 369 Length adjustment: 30 Effective length of query: 363 Effective length of database: 339 Effective search space: 123057 Effective search space used: 123057 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory