Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_037572389.1 BS73_RS14235 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000744815.1:WP_037572389.1 Length = 386 Score = 224 bits (570), Expect = 4e-63 Identities = 132/290 (45%), Positives = 172/290 (59%), Gaps = 8/290 (2%) Query: 3 DIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLR 62 D+ L K + G + +DL I G F LLG SGCGK+T LRMI+GLE + G + Sbjct: 18 DLRLTGLTKKF-GSFTAVDGVDLTIAQGSFFALLGASGCGKTTTLRMISGLEAPTAGRIH 76 Query: 63 IGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALL 122 +G V D R V VFQNYAL+PH+ +++N+AFGLRR R + + V ++ L+ Sbjct: 77 LGDQDVTDRKPYRRPVNTVFQNYALFPHLDIFENVAFGLRR--RGIRSVKKPVEDMLDLV 134 Query: 123 NLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQ 182 L L RKP +SGGQQQR A+ARA+I P V L DEPL LD KLR Q++ ++KR+ Sbjct: 135 ELGHLARRKPTQLSGGQQQRIALARALINQPQVLLLDEPLGALDLKLRRQMQIELKRIQL 194 Query: 183 RLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAMNF 242 + T V+VTHDQ EAMT+AD + +M GRI Q GSPAELY P F A F+G N Sbjct: 195 EVGLTFVHVTHDQEEAMTMADTIAVMNHGRIEQLGSPAELYENPNTTFVANFLG--QSNL 252 Query: 243 LSGTVQRQDGQLFIETAHQR-WALTGERFSRLRHAMAVKLAVRPDHVRIA 291 ++GTV+ G + AH R AL R + V L VRP+ VRIA Sbjct: 253 IAGTVESVSGDVVQVAAHGRSLALPAARCRTT--SGPVILGVRPEKVRIA 300 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 386 Length adjustment: 31 Effective length of query: 375 Effective length of database: 355 Effective search space: 133125 Effective search space used: 133125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory