Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_037572389.1 BS73_RS14235 ABC transporter ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000744815.1:WP_037572389.1 Length = 386 Score = 178 bits (451), Expect = 3e-49 Identities = 101/295 (34%), Positives = 170/295 (57%), Gaps = 17/295 (5%) Query: 4 IRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGY 63 +R+ L+K F AVD V +TI G F +LG SG GKTT LR+I+GLE PT+G Sbjct: 19 LRLTGLTKKFGS----FTAVDGVDLTIAQGSFFALLGASGCGKTTTLRMISGLEAPTAGR 74 Query: 64 IYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKV 123 I+ ++ V+ + P +R + VFQN+AL+P++ +F+N+AF L+ + ++ V Sbjct: 75 IHLGDQDVTDRK-----PYRRPVNTVFQNYALFPHLDIFENVAFGLRRRGIRS--VKKPV 127 Query: 124 KEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARA 183 +++ + + L + R P +LSGGQ QR A+ARAL+ P+VLLLDEP LD ++R + Sbjct: 128 EDMLDLVELGHLARRKPTQLSGGQQQRIALARALINQPQVLLLDEPLGALDLKLRRQMQI 187 Query: 184 LVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLT 243 +++IQ E LT + V+HD + +A+ V+ +G+ Q+G+P E+YE P T +A Sbjct: 188 ELKRIQLEVGLTFVHVTHDQEEAMTMADTIAVMNHGRIEQLGSPAELYENPNTTFVANFL 247 Query: 244 GEINLIQAKIIENNAIIANLKVPLNNMELKG------QSNIVIGLRPDDLTLSDT 292 G+ NLI + + + + ++ L +++G+RP+ + ++ T Sbjct: 248 GQSNLIAGTVESVSGDVVQVAAHGRSLALPAARCRTTSGPVILGVRPEKVRIAKT 302 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 386 Length adjustment: 30 Effective length of query: 341 Effective length of database: 356 Effective search space: 121396 Effective search space used: 121396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory