Align ABC transporter for Lactose, permease component 1 (characterized)
to candidate WP_038210124.1 Q392_RS16585 sugar ABC transporter permease
Query= reanno::Smeli:SM_b21653 (298 letters) >NCBI__GCF_000745855.1:WP_038210124.1 Length = 295 Score = 137 bits (344), Expect = 4e-37 Identities = 89/283 (31%), Positives = 147/283 (51%), Gaps = 13/283 (4%) Query: 20 VAPALGLITLFMVYPIAWSLWMSFQS---GRGMTLKFAGFANIVRLWNDPVFIKALTNTM 76 +APAL + L P+ + W S G FAG N ++ +DP F +L T+ Sbjct: 19 LAPALLALLLVTTVPLVYLAWNSLNRIDLGMPWMSGFAGLDNYAQMGSDPRFWNSLWLTL 78 Query: 77 TYFVVQVPIMILLALILASL-LNNPRLVGRGVFRTAIFLPCVSSLVAYSVLFKGM-FATD 134 Y V + +L+ L LA L L P+ G+GV R LP V + V + ++ + A D Sbjct: 79 VYTASTVVLQVLIGLGLALLVLQIPK--GQGVLRVGAILPIVLAPVVVGLFWRTLVLAPD 136 Query: 135 -GIVNSTLQAIGLAASPIPWLTHPFWAKVLVILAITWRWTGYNMIFYLAALQNIDKSIYE 193 G+V+ +A+GL + WL P A + VI TW+WT + + LA L + IYE Sbjct: 137 VGLVDVATRALGLGSHN--WLGDPQLALISVIAIHTWQWTPFAFLVLLATLSTLPGDIYE 194 Query: 194 VARIDGVPAWARLTHLTIPLLKPVILFTTVISTIGTLQLFDEVYNLTEGKGGPSNATLTL 253 AR+D AW R H+T+PL++P ++ ++ T+ L F ++ T GGP +AT L Sbjct: 195 AARLDRAGAWQRFRHITLPLIRPAVVMVVILRTMTALSAFAAIFAAT--GGGPGSATEIL 252 Query: 254 SLYIYNLTFRFMPNLGYAATVSYVIVVLVALLAFVQFFAARER 296 +LY Y +F + N+GY ++++ V++ + ++++ F + R Sbjct: 253 NLYAYRTSFTEL-NIGYGSSLAMVLLGITLAVSWLMFRLRKAR 294 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 295 Length adjustment: 26 Effective length of query: 272 Effective length of database: 269 Effective search space: 73168 Effective search space used: 73168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory