Align ABC transporter for D-Sorbitol, permease component 2 (characterized)
to candidate WP_038211951.1 Q392_RS21215 sugar ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2943 (316 letters) >NCBI__GCF_000745855.1:WP_038211951.1 Length = 285 Score = 426 bits (1095), Expect = e-124 Identities = 202/283 (71%), Positives = 244/283 (86%) Query: 33 RLLPRLLLTPAMATLFLWMIVPLVMTIYFSLIRYNLMQPDQTGFAGLENFEFFVTDPSFG 92 RLLPR L+ PA+ TLFLWMIVPL MT+YFS + YNLMQP + FAG++NF +FVTDP F Sbjct: 3 RLLPRALMAPAVLTLFLWMIVPLAMTLYFSFVNYNLMQPGEHPFAGIDNFHYFVTDPDFW 62 Query: 93 TAVVNTILLLGSVILITVVLGVAIALLINEPFPGRGIVRVLLISPFFVMPTVNALMWKNM 152 +V NT+LL+GSVI TVVLG+ +ALLI+ PFPGRGIVRVLLISPFFVMPTVNAL+WK+M Sbjct: 63 PSVGNTLLLIGSVIAATVVLGIGLALLIDAPFPGRGIVRVLLISPFFVMPTVNALLWKHM 122 Query: 153 MMNPIYGVLAQVWIFFGAAPVDWLTDHPLFSVIVMVSWQWLPFATLIFMTALQSMNHEQL 212 MMNPIYG+LA VW FFGA PVDW+ D PL SVI+MV+WQWLPFA LIFMT+LQS++ EQ+ Sbjct: 123 MMNPIYGILADVWRFFGAEPVDWMADWPLLSVIIMVAWQWLPFACLIFMTSLQSLDREQM 182 Query: 213 EASRMDGANYLQQLRYLYVPHLGRSVAVVVMIELIFLLSIFAEIYTTTAGGPGDASTNVT 272 EA+RMDGA Q+ YL +PHL R +AVV+MIE+IFLLS+FAEI TTAGGPG+ASTN+T Sbjct: 183 EAARMDGAGPFQRFFYLVLPHLARPMAVVIMIEMIFLLSVFAEIAITTAGGPGNASTNLT 242 Query: 273 FLIFKQALLNFDAGVASAGALFAVVLANIAAVFLIRMVGKNLD 315 +LI+KQ+L+NFD G+ASAGALFAV+LAN+ A FLIR++GKNLD Sbjct: 243 YLIYKQSLMNFDVGIASAGALFAVILANVVAAFLIRIIGKNLD 285 Lambda K H 0.331 0.142 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 285 Length adjustment: 27 Effective length of query: 289 Effective length of database: 258 Effective search space: 74562 Effective search space used: 74562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory