Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_038211946.1 Q392_RS21205 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2941 (350 letters) >NCBI__GCF_000745855.1:WP_038211946.1 Length = 346 Score = 449 bits (1154), Expect = e-131 Identities = 237/347 (68%), Positives = 271/347 (78%), Gaps = 6/347 (1%) Query: 1 MAYLQLRGIEKFFGEHRAIKGIDLTIQQGEFIVFVGPSGCGKSTLLRLIAGLEAIDGGSL 60 MA+L+LRGI K FG+ IKG+DL I++GEFIVFVGPSGCGKSTLLRLIAGLE I G+L Sbjct: 1 MAFLELRGIRKSFGDAHIIKGVDLAIEKGEFIVFVGPSGCGKSTLLRLIAGLEPITSGTL 60 Query: 61 MLDGRDITDQPSSKRDLAMVFQSYALYPHMSVYENMSFALKLAKVDKQVIDEKVQNAARI 120 MLDGRDIT PS KRDLAMVFQSYALYPHMSVY+NMSFALKLAKV I KV+ AA Sbjct: 61 MLDGRDITHAPSGKRDLAMVFQSYALYPHMSVYDNMSFALKLAKVPADEIRRKVEAAAEK 120 Query: 121 LNLTQYLQRTPKELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQTRVEIAKLH 180 LNL+ YLQRTP+ELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRG TRVEI KLH Sbjct: 121 LNLSSYLQRTPRELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGNTRVEIKKLH 180 Query: 181 RDLGATTIYVTHDQVEAMTLADRVVVLRDGIIEQVGTPLELYDKPANQFVAQFIGTPQMN 240 LGATTIYVTHDQVEAMTLADRVVVL+DG+IEQVG+PLELYD+PANQFVAQFIG P MN Sbjct: 181 EALGATTIYVTHDQVEAMTLADRVVVLKDGLIEQVGSPLELYDRPANQFVAQFIGMPSMN 240 Query: 241 VVPVDKLPQPVQQQAPAAPAGAAVGAIGLRPENITVRTTGATPVG--GQVDLIEALGAET 298 ++P LP + P G +G+RPE + V G G+VDL+EALG++T Sbjct: 241 MLPAGALPVLSELTGGRLPQD---GYLGVRPEGVRVHAGAGAGAGLPGRVDLVEALGSDT 297 Query: 299 LIYVTTPGGAQFVSRQNDRTDLRVGDAVSLDIDASQAHWFDTAGRVV 345 LI+V G ++RQN+RT L GDAV ++ID + H F+ GR + Sbjct: 298 LIHVDV-AGRMLIARQNERTSLAHGDAVGVEIDPAVLHLFNREGRAL 343 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 346 Length adjustment: 29 Effective length of query: 321 Effective length of database: 317 Effective search space: 101757 Effective search space used: 101757 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory