Align sorbitol dehydrogenase, D-fructose forming (EC 1.1.1.14) (characterized)
to candidate WP_038211943.1 Q392_RS21195 L-iditol 2-dehydrogenase
Query= reanno::BFirm:BPHYT_RS16120 (260 letters) >NCBI__GCF_000745855.1:WP_038211943.1 Length = 262 Score = 313 bits (803), Expect = 2e-90 Identities = 167/262 (63%), Positives = 197/262 (75%), Gaps = 2/262 (0%) Query: 1 MAARLQDKVAILTGAASGIGEAVARRYLDEGARCVLVDVKP-ADSFGDSLRATYGDRVLT 59 M RL + ++TGA GIG A+A EGARC LVD P A + + A++ + Sbjct: 1 MTPRLDQRHVLITGAGGGIGLAMALACRAEGARCTLVDRAPQAPAEAAAALASHPQALHY 60 Query: 60 VSADVTRRDDIQRIVASTLERFGQIDILFNNAALFDMRPILEESWDVFDRLFAVNVKGMF 119 V+ADVTRR DI R++ + RFG + L NNAA+FD+ P+LE FDRLFAVNVKGMF Sbjct: 61 VAADVTRRADIDRLLPEAVARFGPVHTLINNAAVFDLAPLLESDEASFDRLFAVNVKGMF 120 Query: 120 FLMQAVAQKMVEQGC-GGKIINMSSQAGRRGEALVSHYCATKAAVLSYTQSAALALAPHK 178 F+MQAV + MVE G G +INM+SQAGRRGEALVSHYCATKAAV+SYTQSAALA+APH Sbjct: 121 FVMQAVLRHMVEAGTQGASVINMASQAGRRGEALVSHYCATKAAVISYTQSAALAMAPHG 180 Query: 179 INVNGIAPGVVDTPMWNEVDALFARYENRPLGEKKRLVGEAVPLGRMGVPDDLTGAALFL 238 I VNGIAPGVVDTPMW +VD LFAR+EN P GEKKR VG AVPLGRMG+P D+ GAA+FL Sbjct: 181 IRVNGIAPGVVDTPMWEQVDGLFARHENLPRGEKKRQVGLAVPLGRMGLPQDVAGAAVFL 240 Query: 239 ASADADYITAQTLNVDGGNWMS 260 AS +A YITAQTLNVDGGN M+ Sbjct: 241 ASDEARYITAQTLNVDGGNVMN 262 Lambda K H 0.321 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 262 Length adjustment: 25 Effective length of query: 235 Effective length of database: 237 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory