Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_038210124.1 Q392_RS16585 sugar ABC transporter permease
Query= uniprot:D8IPH8 (292 letters) >NCBI__GCF_000745855.1:WP_038210124.1 Length = 295 Score = 135 bits (341), Expect = 8e-37 Identities = 84/274 (30%), Positives = 150/274 (54%), Gaps = 5/274 (1%) Query: 14 LGPSLLVMLVLGLVPTVAAINLALKNRVLRYP-DSDYVWLRNLERLMSDRRFLNAIEVSA 72 L P+LL +L++ VP V +L L P S + L N ++ SD RF N++ ++ Sbjct: 19 LAPALLALLLVTTVPLVYLAWNSLNRIDLGMPWMSGFAGLDNYAQMGSDPRFWNSLWLTL 78 Query: 73 VWEVVTVLGAVIVGIAIAVYLFENVHGKWRQAMCVLLITPVLLPRVSAAFIWK-FMYSPL 131 V+ TV+ V++G+ +A+ + + G+ + V I P++L V W+ + +P Sbjct: 79 VYTASTVVLQVLIGLGLALLVLQIPKGQG--VLRVGAILPIVLAPVVVGLFWRTLVLAPD 136 Query: 132 TGILGWLLGLVGIHDTAFLSDPALALYAVALVDIWQWGLFFAVIVLKLLETLPPEPLEAA 191 G++ +G+ +L DP LAL +V + WQW F +++L L TLP + EAA Sbjct: 137 VGLVDVATRALGLGSHNWLGDPQLALISVIAIHTWQWTPFAFLVLLATLSTLPGDIYEAA 196 Query: 192 RLDYARTWQVYAYIALPMLKGPLISLVFIKMVESLRSFDLIYVMTKGGPGVATETLDMYA 251 RLD A WQ + +I LP+++ ++ +V ++ + +L +F I+ T GGPG ATE L++YA Sbjct: 197 RLDRAGAWQRFRHITLPLIRPAVVMVVILRTMTALSAFAAIFAATGGGPGSATEILNLYA 256 Query: 252 YAQGIGLSGKVSYASTMAVLMMIATTLIFTLIWK 285 Y + Y S++A++++ T + L+++ Sbjct: 257 YRTSF-TELNIGYGSSLAMVLLGITLAVSWLMFR 289 Lambda K H 0.328 0.141 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 295 Length adjustment: 26 Effective length of query: 266 Effective length of database: 269 Effective search space: 71554 Effective search space used: 71554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory