Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_038208119.1 Q392_RS13490 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
Query= BRENDA::Q8GR61 (262 letters) >NCBI__GCF_000745855.1:WP_038208119.1 Length = 255 Score = 152 bits (385), Expect = 5e-42 Identities = 89/260 (34%), Positives = 132/260 (50%), Gaps = 11/260 (4%) Query: 3 KKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYV 62 ++F + +VTG GG IG A R A EG +A+ D+N EA + +RE G A + Sbjct: 2 QRFEDRTVVVTGGGGGIGGAACRRFAREGAKVAVFDLNEEAAAQVAGQIREAGGRAEAVR 61 Query: 63 CDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFH 122 CD+T +V V G ID L NNAG+ F P S D+ R++ +N+TGA H Sbjct: 62 CDITDRASVDAAVAQAQARLGAIDVLVNNAGWD-VFKPFTRTTSADWERLVAVNLTGALH 120 Query: 123 VLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRV 182 + AV M + GRIVN AS A G A Y KG ++AL++T A + A + I V Sbjct: 121 MHHAVLPGMAARKAGRIVNIASDAARVGSSGEAVYAACKGGLVALSKTLAREHARHGITV 180 Query: 183 NAISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVA 242 N + PG + + G +P+ + + S+P+ R G ++PG +A Sbjct: 181 NVVCPGPTDTALF----ADYREGAG------NPEKLMEAFTRSIPLGRIGQPEDLPGAIA 230 Query: 243 FLLGDDSSFMTGVNLPIAGG 262 F DD++F+TG L ++GG Sbjct: 231 FFASDDAAFVTGQVLSVSGG 250 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 255 Length adjustment: 24 Effective length of query: 238 Effective length of database: 231 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory