Protein WP_051958033.1 in Desulfobacter vibrioformis DSM 8776
Annotation: NCBI__GCF_000745975.1:WP_051958033.1
Length: 419 amino acids
Source: GCF_000745975.1 in NCBI
Candidate for 8 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-glutamate catabolism | gtrB | med | GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter (characterized) | 37% | 95% | 301.2 | Alr3027 protein, component of The 2-oxo monocarboxylate transporter (Pernil et al., 2010). Transports pyruvate which is inhibited by various 2-ketoacids | 37% | 292.4 |
| pyruvate catabolism | dctM | lo | Alr3027 protein, component of The 2-oxo monocarboxylate transporter (Pernil et al., 2010). Transports pyruvate which is inhibited by various 2-ketoacids (characterized) | 37% | 95% | 292.4 | GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter | 37% | 301.2 |
| 4-hydroxybenzoate catabolism | fcbT3 | lo | FcbT3, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized) | 34% | 95% | 251.1 | GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter | 37% | 301.2 |
| D-gluconate catabolism | gntB | lo | TRAP-type large permease component (characterized, see rationale) | 31% | 97% | 196.8 | GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter | 37% | 301.2 |
| 2-oxoglutarate (alpha-ketoglutarate) catabolism | dctM | lo | dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized) | 30% | 86% | 143.3 | GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter | 37% | 301.2 |
| L-malate catabolism | dctM | lo | dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized) | 30% | 86% | 143.3 | GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter | 37% | 301.2 |
| fumarate catabolism | dctM | lo | dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized) | 30% | 86% | 143.3 | GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter | 37% | 301.2 |
| succinate catabolism | dctM | lo | dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized) | 30% | 86% | 143.3 | GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter | 37% | 301.2 |
Sequence Analysis Tools
View WP_051958033.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MTLLLLGVPVAFALGGITVVLTCLLEGSTSLFIVATTTYKQITDPNLITIPLFLLMGNFL
LHSGISDRMFKALGFWLTGIKGGLAIISIGVCVALAMCGGFGPGILTMGLIAVPAMLKQS
YNRSLALGSVMAGGVLGEIIPPSIIMIIFAYIARVSIGKLFLAGVIPGLITAFGYILYIS
IRCQLQPEFAPPVKETVTWKLRLSSLKDILLPALLIVLVLGSIFFGIATPTEAAGVGATG
AFVICVLLKKMSWKVLWDSCRQTMTISGMVFWILIGATLFSVFYTSQGAQSLVTELVSTL
EINRWIVLGGMQLILLVLGMFMDDYAVVTICAPIFVPIAKVLGFDPIWFSIIFILNMQVA
YLTPPFGWALIMMKGVAPPEITTRDIWKSIPPFVAIQLIVLILVMIFPQLALWLTDSML
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory