Align D-lactate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate WP_035239519.1 Q366_RS12750 FAD-linked oxidase C-terminal domain-containing protein
Query= reanno::Cup4G11:RR42_RS17310 (374 letters) >NCBI__GCF_000745975.1:WP_035239519.1 Length = 469 Score = 81.6 bits (200), Expect = 4e-20 Identities = 61/193 (31%), Positives = 89/193 (46%), Gaps = 13/193 (6%) Query: 5 PADQQATLTAFRDAIRHATGTRTPLRLRGGGSKDFYGQHPQ--GTLLDTRAYSGIVDYDP 62 PAD +A A H R P+ RG G+ G P G ++ + I+D D Sbjct: 46 PADARAVSRIMTLAHHH----RIPVYPRGSGTGFTGGALPVCGGIVMGMSRMNRILDIDQ 101 Query: 63 PELVITARCGTPLAQIEAALAERRQMLAFEPPHFSTGADGSDVATIGGAVAAGLSGPRRQ 122 LV G + A+ + F PP ++ V+++GG VA GPR Sbjct: 102 ENLVAVVEPGVVTGDFQKAV---EALGLFYPPDPAS----LKVSSLGGNVAECAGGPRCV 154 Query: 123 AVGALRDFVLGTRVMDGRGDVLSFGGQVMKNVAGYDVSRLMSGSLGTLGLILEVSLKVLP 182 G +D+V+G V+ GD + GG MK V GYD+++L GS GTL +I ++ LK+LP Sbjct: 155 KYGVTKDYVIGLEVVTPTGDRIETGGTTMKGVVGYDLTKLFCGSEGTLAVITKIILKLLP 214 Query: 183 VPFDDATLRFALD 195 P T+ D Sbjct: 215 KPQAKKTMLVVFD 227 Lambda K H 0.321 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 469 Length adjustment: 32 Effective length of query: 342 Effective length of database: 437 Effective search space: 149454 Effective search space used: 149454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory