Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate WP_035238355.1 Q366_RS09340 TRAP transporter large permease subunit
Query= SwissProt::Q9HU16 (427 letters) >NCBI__GCF_000745975.1:WP_035238355.1 Length = 426 Score = 253 bits (645), Expect = 1e-71 Identities = 136/419 (32%), Positives = 240/419 (57%), Gaps = 9/419 (2%) Query: 9 LLFLLMFIGVPIAVSLGLSGALTILLFSPDSVRSLAIKLFETSEHYTLLAIPFFLLSGAF 68 LL + +G P+ + ++ A+ S + +AI+L+ ++ LLA+P F +G Sbjct: 8 LLIVFALMGAPLFTVI-IAAAMYGFHLSEIDLSVMAIELYRIADTPILLALPLFTFAGYI 66 Query: 69 MTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGSIAIAGMVR 128 + ++RL+ A +G + GGLAI A + C LF A +G+S T+ A+G++ + + Sbjct: 67 LGESNTSQRLVTLTRAFLGWMPGGLAIVAFVVCALFTAFTGASGVTIVAMGALLYPALTQ 126 Query: 129 SGYPQAFGAGIVCNAGTLGILIPPSIVMVVYA-------AATETSVGKLFIAGVVPGLLL 181 +GY F G+V +G+LG+L+PPS+ +++Y + S+ LF+AG+ P LL+ Sbjct: 127 AGYTDRFSLGLVTTSGSLGLLLPPSLPLILYGIIAQQMNGGEQVSIENLFLAGLFPALLM 186 Query: 182 GLILMVVIYIVARVKKLPAMPRVSLREWLASARKALWGLLLMVIILGGIYSGAFTPTEAA 241 ++L R ++P + R S+R L + + A W + L + + GIYSG F +EAA Sbjct: 187 IVMLSAWSVWANRGNQVPLI-RFSVRNCLLALKAAGWEVPLPLFVFFGIYSGYFAVSEAA 245 Query: 242 AVAAVYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIPQSI 301 AV A+Y V + +YR++ L + P ++ ES + ++ I+ ++ + L + P + Sbjct: 246 AVTAMYVLVVEVLIYREIPLKKLPGIIRESMVMVGGILLILGVSLALTNYLIDVEAPMKL 305 Query: 302 ASWVTELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLGIIM 361 + S +FL+++NI LLI G ++ + I+I+ P+ P+A+E G+ P+HLGII Sbjct: 306 FKFCETFVSSKLVFLILLNIFLLILGAMLDIFSAIIIMVPLMLPVALEYGVHPVHLGIIF 365 Query: 362 VVNMEIGLITPPVGLNLFVTSAVTGMPLGATIRAALPWLMILLVFLIIVTYIPAVSLAL 420 + NM+IG TPPVG+NLF+ S P+ RA +P++++LL+ ++I+TY P +SL L Sbjct: 366 LANMQIGYFTPPVGMNLFIASYRFNKPIVEIYRATIPFMLVLLLSVLIITYWPQLSLFL 424 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 426 Length adjustment: 32 Effective length of query: 395 Effective length of database: 394 Effective search space: 155630 Effective search space used: 155630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory