Align Glyceraldehyde dehydrogenase small chain; Glyceraldehyde dehydrogenase subunit C; Glyceraldehyde dehydrogenase subunit gamma; EC 1.2.99.8 (characterized)
to candidate WP_035235863.1 Q366_RS02010 (2Fe-2S)-binding protein
Query= SwissProt::Q4J6M5 (163 letters) >NCBI__GCF_000745975.1:WP_035235863.1 Length = 157 Score = 152 bits (383), Expect = 3e-42 Identities = 71/153 (46%), Positives = 100/153 (65%), Gaps = 1/153 (0%) Query: 10 VKVRVRVNGVWYEKYVSPRTLLVDFIRDELGLTGTKVGCDTTTCGACTVIMNGKSVKSCT 69 +K+ +N +P L+D +R++LGLTGTK GC T CGACT+ + G++ +C Sbjct: 1 MKLEFTLNSAKVTVETAPDRRLIDLLREDLGLTGTKEGCGTGECGACTIRVQGETKLACL 60 Query: 70 VLAAQADGAEITTIEGLSSDSKLHPIQEAFKDNFALQCGFCTAGMIMQTYFFLKEHPNPT 129 +LAAQ G ++ TIEGL HP+QEAF + A+QCGFCT GMIM +L HP+P Sbjct: 61 MLAAQVQGCDVVTIEGLDPAGH-HPVQEAFTGSGAVQCGFCTPGMIMSLSTYLAAHPDPA 119 Query: 130 EEEVRDGIHGNICRCTGYQNIVKAVLDASKRLR 162 E++R+ + GN+CRCTGYQ IV A L A++ L+ Sbjct: 120 PEKIREAVSGNLCRCTGYQKIVDAGLAAARALK 152 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 157 Length adjustment: 17 Effective length of query: 146 Effective length of database: 140 Effective search space: 20440 Effective search space used: 20440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory