Align L-ribulose-5-phosphate 4-epimerase UlaF; EC 5.1.3.4; L-ascorbate utilization protein F; Phosphoribulose isomerase (uncharacterized)
to candidate WP_035241760.1 Q366_RS17895 L-fuculose-phosphate aldolase
Query= curated2:A7ZV69 (228 letters) >NCBI__GCF_000745975.1:WP_035241760.1 Length = 219 Score = 97.8 bits (242), Expect = 1e-25 Identities = 67/202 (33%), Positives = 101/202 (50%), Gaps = 13/202 (6%) Query: 1 MQKLKQQVFEANMDLPRYGLVTFTWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDM 60 ++ ++ V + + GL T T GN+S IDR+ G V + PSG+ Y ++ D+V+ DM Sbjct: 3 LENERKAVVRFGLKMVESGLTTGTGGNLSIIDRKSGTVAVSPSGIEYAVLQPRDVVLTDM 62 Query: 61 SGKVVEGEYRPSSDTATHLELYRRYPSLGGIVHTHSTHATAWAQAGLAIPALGTTHADYF 120 G V++GE RPSS+ HL LY + + IVHTHS +A A G IPA+ Y Sbjct: 63 QGNVIDGEARPSSELGFHLSLYGQRKDIQAIVHTHSPYAVTMACLGWEIPAV-----HYL 117 Query: 121 FGDIPYTRGLSEEEVQGEYELNTGKVIIETLGNAEPLHTPGIVVYQHGPFAWGKDAHDAV 180 G L+ G EL +++ E +G+ L ++ HG A G A Sbjct: 118 VGFAGKKVPLAPYATFGTPEL--AQIVAEYIGDYNAL-----LLANHGLVAVGSSMDTAF 170 Query: 181 HNAVVMEEVAKMAWIARSI-NP 201 A +E VA++ + +SI NP Sbjct: 171 AAAEEIEFVARIYYQTKSIGNP 192 Lambda K H 0.318 0.134 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 219 Length adjustment: 22 Effective length of query: 206 Effective length of database: 197 Effective search space: 40582 Effective search space used: 40582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory