Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_035236530.1 Q366_RS04020 phosphoglycerate dehydrogenase
Query= curated2:B1L765 (332 letters) >NCBI__GCF_000745975.1:WP_035236530.1 Length = 527 Score = 200 bits (509), Expect = 6e-56 Identities = 109/320 (34%), Positives = 189/320 (59%), Gaps = 11/320 (3%) Query: 4 RVFVTREIPERGLS--KIEEHFELDLWKDEAPPSKKVIIERVKDCDALVSLLTDPIDAEV 61 +V ++ ++ E G++ + +E ++D+ +P K II + DAL + + A++ Sbjct: 2 KVLISDKMDEAGINIFRNQEGIDVDVNTGLSPEELKKIIGQY---DALAIRSSTKVTADL 58 Query: 62 FEAAPKLRIVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETTADFAFALLMAAARRVVE 121 EAA L+++A+ +G DN+D+ ATK+G+ V NTPG T TTA+ A A++MA R + Sbjct: 59 LEAAGNLKVIARAGIGLDNVDIDAATKKGVAVMNTPGGNTVTTAEHAMAMMMALTRNIPR 118 Query: 122 ADRYVREGKWKVAWHPMMMLGYDVYGRTLGIVGMGRIGAAVARRAKGFGMRILYYD-SIR 180 ++ G+W ++ G +++ +TLG+VG G IG+ VA AKG M ++ YD +I Sbjct: 119 GTASLKAGRWD----KKLLQGREIFNKTLGVVGFGNIGSIVAGLAKGMRMNVIVYDPNIS 174 Query: 181 REDFEKELGVEYVPLEKLLEESDFVSLHVPLTEETYHMIGEEQLRRMKRTAILVNTSRGK 240 E EK G EYV L++L SD++++HVP + T ++ + +MK +++N +RG Sbjct: 175 SEHIEK-AGFEYVSLDELYARSDYITIHVPKMDATIDLLDAQAFEKMKTGVMVINCARGG 233 Query: 241 VVDQKALYKALKEGWIAGAGLDVFEQEPIPPDDPLLKLENVVLAPHAASASHETRSRMAE 300 +V++ AL++A++ G +AGA LDVF EP D PLL L+ V+ PH +++ E ++ ++ Sbjct: 234 IVNEAALHEAIQSGKVAGAALDVFSTEPPGGDHPLLLLDQVIATPHLGASTKEAQTNVSV 293 Query: 301 MVAENLIAFKRGEIPPNLVN 320 A +IA+ + N VN Sbjct: 294 AAANQIIAYLLHDTVINAVN 313 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 527 Length adjustment: 32 Effective length of query: 300 Effective length of database: 495 Effective search space: 148500 Effective search space used: 148500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory