Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; EC 2.3.1.9 (characterized)
to candidate WP_035235994.1 Q366_RS02505 acetyl-CoA C-acetyltransferase
Query= SwissProt::Q0AVM3 (396 letters) >NCBI__GCF_000745975.1:WP_035235994.1 Length = 428 Score = 409 bits (1052), Expect = e-119 Identities = 215/428 (50%), Positives = 285/428 (66%), Gaps = 38/428 (8%) Query: 3 REVVLVGACRTPVGTFGGTLKDVGSAQLGAIVMGEAIKRAGIKAEQ-------------- 48 +E V+V RT VGTFGG+LK V +LG VM + +KRAG+K Q Sbjct: 2 QEAVIVSGVRTSVGTFGGSLKSVPVVELGTYVMKDVLKRAGLKPAQDPGNDEFSPATLKD 61 Query: 49 ---------------------IDEVIFGCVLQAGLGQNVARQCMINAGIPKEVTAFTINK 87 +DEVI G VLQAG GQN ARQ MI AGI + A T+NK Sbjct: 62 QGMIDIENSGYDYGDDLTDIYVDEVIMGNVLQAGQGQNTARQAMIGAGISRTTPAMTVNK 121 Query: 88 VCGSGLRAVSLAAQVIKAGDADIIMAGGTENMDKAPFILPNARWGYRMSMP-KGDLIDEM 146 +CGSGL+A++L AQ I AG A +++AGG E+M AP L ARWG+RM + +G + D M Sbjct: 122 ICGSGLKAIALGAQAILAGQAQVVLAGGQESMSNAPMALLKARWGHRMELTGQGPVHDLM 181 Query: 147 VWGGLTDVFNGYHMGITAENINDMYGITREEQDAFGFRSQTLAAQAIESGRFKDEIVPVV 206 V+ GL ++F GYHMG TAENI + YGITR+EQD S T A A+ G F EIVPVV Sbjct: 182 VYDGLYEIFYGYHMGQTAENIVEKYGITRQEQDELALLSHTRALGAVHDGTFDQEIVPVV 241 Query: 207 IKGKKGDIVFDTDEHPRKSTPEAMAKLAPAFKKGGSVTAGNASGINDAAAAVIVMSKEKA 266 IK +KGDIV + DE P +++ E +AKL PAF+K GSVTAGNASGIND AAAV++M+ ++A Sbjct: 242 IKNRKGDIVVNKDERPMETSMEKLAKLRPAFRKDGSVTAGNASGINDGAAAVLMMTAQRA 301 Query: 267 DELGIKPMAKVVSYASGGVDPSVMGLGPIPASRKALEKAGLTIDDIDLIEANEAFAAQSI 326 ELG++ +A V +ASGG+DP+ MGLGP+PA ++ L++ G+ + DID+IE NEAFAAQ+I Sbjct: 302 KELGLEVLATVKGFASGGLDPAYMGLGPVPAVKRVLKQTGMALSDIDMIELNEAFAAQAI 361 Query: 327 AVARDLGWADKMEKVNVNGGAIAIGHPIGSSGARILVTLLYEMQKRGSKKGLATLCIGGG 386 R+L +E+ N G I++GHPIG +GAR +VT +++MQ++G GL ++CIGGG Sbjct: 362 GCMRELD--IDVERPNELGSGISLGHPIGCTGARQMVTAIHQMQRKGYNTGLISMCIGGG 419 Query: 387 MGTALIVE 394 MG A+IVE Sbjct: 420 MGMAMIVE 427 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 396 Length of database: 428 Length adjustment: 31 Effective length of query: 365 Effective length of database: 397 Effective search space: 144905 Effective search space used: 144905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory