Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate WP_035241898.1 Q366_RS18135 enoyl-CoA hydratase-related protein
Query= CharProtDB::CH_091794 (261 letters) >NCBI__GCF_000745975.1:WP_035241898.1 Length = 261 Score = 251 bits (641), Expect = 1e-71 Identities = 123/256 (48%), Positives = 174/256 (67%) Query: 1 MELNNVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEK 60 M N+ILE + +A++T NRPKALNALN+ L E+D + ++ + E+ +ILTG+G+K Sbjct: 1 MSFENIILEMDSTIAMITFNRPKALNALNNALLDELDVALDQVLANKEIRVLILTGSGDK 60 Query: 61 SFVAGADISEMKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCD 120 +FVAGADISE+ M+T+ + F G K+F ++E L P IAAVNGFALGGG E+A++CD Sbjct: 61 AFVAGADISELTRMDTLAAKYFSRKGQKIFSKIEALPFPAIAAVNGFALGGGSEVALACD 120 Query: 121 IRIASSNARFGQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVN 180 AS A FG PE+ LG+ PGFGGTQRL RLVG AK++IFT NI AD+AL G+VN Sbjct: 121 FIYASEKAVFGLPEINLGLIPGFGGTQRLPRLVGKNRAKEMIFTGANITADKALEYGMVN 180 Query: 181 KVVEPSELMNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFSTE 240 +V LM+ ++ A +I V+++ +K+AI GM CD++T E++AF ++ Sbjct: 181 QVCPHESLMDEVQKTARRIAGKGCVSLRAAKEAIQAGMGCDLETGCLIENDAFAIAVASP 240 Query: 241 DQKDAMTAFIEKRKIE 256 D K+ +AF+EKRK E Sbjct: 241 DAKEGTSAFLEKRKPE 256 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 261 Length adjustment: 25 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory