Align Succinate-semialdehyde dehydrogenase, mitochondrial; At-SSADH1; Aldehyde dehydrogenase family 5 member F1; NAD(+)-dependent succinic semialdehyde dehydrogenase; Protein ENLARGED FIL EXPRESSING DOMAIN 1; EC 1.2.1.24 (characterized)
to candidate WP_035239687.1 Q366_RS12840 aldehyde dehydrogenase family protein
Query= SwissProt::Q9SAK4 (528 letters) >NCBI__GCF_000745975.1:WP_035239687.1 Length = 470 Score = 284 bits (727), Expect = 4e-81 Identities = 168/459 (36%), Positives = 257/459 (55%), Gaps = 5/459 (1%) Query: 56 LIGGKWLDSYDNKTIKVNNPATGEIIADVACMGTKETNDAIASSYEAFTSWSRLTAGERS 115 +I GK + S + T V NPATG++ A ++ ++A+A++ +AF WS L +R Sbjct: 7 IINGKKVLS--DTTFDVVNPATGDVFAKCPRATIEQLDEAVAAARKAFPGWSALADDQRV 64 Query: 116 KVLRRWYDLLIAHKEELGQLITLEQGKPLKEAIGEVAYGASFIEYYAEEAKRVYGDIIPP 175 K++ R ++ ++ EL LIT EQGKPL G + ++ +++ Sbjct: 65 KIMNRIAGIIEQNQAELAGLITREQGKPLSGPGSMFEVGGCMAWTQVTASMKLEPELVDD 124 Query: 176 NLSDRRLLVLKQPVGVVGAITPWNFPLAMITRKVGPALASGCTVVVKPSELTPLTALAAA 235 N D + + ++P+GVVG+ITPWN+PL + + PAL GCTVV+KP+ TPL L Sbjct: 125 NPEDT-IELYRKPIGVVGSITPWNWPLLIAVWHIMPALRVGCTVVLKPASYTPLATLRLV 183 Query: 236 ELALQAGVPPGALNVVMGNAPEIGDALLTSPQVRKITFTGSTAVGKKLMAAAAPTVKKVS 295 EL +A +PPG LNVV G++ EIG+A+ + KI FTGS VG+ +M AA +K ++ Sbjct: 184 ELINEA-LPPGVLNVVSGSS-EIGNAMSAHKGIDKIVFTGSIPVGQTIMGRAASNLKSLT 241 Query: 296 LELGGNAPSIVFDDADLDVAVKGTLAAKFRNSGQTCVCANRVLVQDGIYDKFAEAFSEAV 355 LELGGN I+ D+ ++ F N+GQTC R+ V + Y+ + F++ V Sbjct: 242 LELGGNDAGIILPGTDVTPLLEPLFWGCFINAGQTCAALKRLFVHEDDYEDVCQKFTDYV 301 Query: 356 QKLEVGDGFRDGTTQGPLINDAAVQKVETFVQDAVSKGAKIIIGGKRHSLGMTFYEPTVI 415 K+ VGDG + GPL N ++ V+ +V DA KGA+++ GG S FY T++ Sbjct: 302 TKIPVGDGMDEKNLIGPLGNGPQLETVKQYVDDAREKGARVLCGGTPCSGPGYFYPLTLV 361 Query: 416 RDVSDNMIMSKEEIFGPVAPLIRFKTEEDAIRIANDTIAGLAAYIFTNSVQRSWRVFEAL 475 DV+D+M + KEE FG P+I++ T ++A++ AN GL ++N +++ V L Sbjct: 362 ADVTDDMDLVKEEQFGTALPIIKYATVDEAVQRANSLDVGLGGSAWSNDPEKAKAVAMRL 421 Query: 476 EYGLVGVNEGLISTEVAPFGGVKQSGLGREGSKYGMDEY 514 E G V VN +APFGGVK SG+G E G+ Y Sbjct: 422 EAGTVWVNAHGKLHPMAPFGGVKSSGIGSEFGLEGLKAY 460 Lambda K H 0.317 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 528 Length of database: 470 Length adjustment: 34 Effective length of query: 494 Effective length of database: 436 Effective search space: 215384 Effective search space used: 215384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory