Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_051957879.1 Q366_RS07000 aminotransferase
Query= reanno::pseudo3_N2E3:AO353_08585 (454 letters) >NCBI__GCF_000745975.1:WP_051957879.1 Length = 463 Score = 320 bits (820), Expect = 6e-92 Identities = 179/451 (39%), Positives = 266/451 (58%), Gaps = 24/451 (5%) Query: 14 LSSEHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELA 73 + +H + P+SD + II + KG++++D+EGN+ +D ++G+WCV +GY +E+A Sbjct: 20 IDKKHIIHPWSDLGS--DARSMIIESGKGIHVFDNEGNQYIDSISGMWCVNLGYANEEMA 77 Query: 74 DAASKQMRELPYYNLFFQTAHPPVLELAKAISDIAPEGMNHVFFTGSGSEGNDTMLRMVR 133 +A + Q L YY F A PP +ELA +S + P +NH FT SGS ++ +R V Sbjct: 78 EAIADQCIRLVYYTPFGAMASPPSIELAHQLSQLTPGDLNHFQFTTSGSTAVESAIRFVH 137 Query: 134 HYWAIKGQPNKKVIISRINGYHGSTVAGASLGG----MTYMHEQGDLPIPGIVH-IPQPY 188 +Y+ QP KK II R N YHGST ASL G +Y H I IVH IP P Sbjct: 138 YYFNCLDQPEKKHIIYRENAYHGSTYLSASLNGKKCDRSYFHY-----ITDIVHAIPDPN 192 Query: 189 WFGEGGDMTPEEFGIWAANQLEEKILELGVDTVGAFIAEPIQGAGGVIIPPDSYWPRIKE 248 + M+ E+F +LEEKIL LG D FIAEP+ G+GGVI+PP Y R + Sbjct: 193 PYKREPGMSVEDFCDLRVRELEEKILALGPDKAACFIAEPVMGSGGVIVPPPGYHKRTLD 252 Query: 249 ILAKYDILFVADEVICGFGRTGEWFGS-DFYGLKPDMMTIAKGLTSGYIPMGGLIVRDEV 307 I KYD+L+++DEV+ FGR G F S D + + PD++T+AKG++SGY P+G I+ +++ Sbjct: 253 ICRKYDVLYISDEVVTAFGRLGHHFASEDVFDIVPDIITVAKGISSGYQPLGAAIISEKL 312 Query: 308 VEVLN-----EGGDFNHGFTYSGHPVAAAVALENIRILREEKIIEHVRAETAPYLQKRLR 362 + ++ + + +GFTYSGHPVA A AL+ + I+ + I EHVR E PY +RL Sbjct: 313 MNRISGASARQNSYYTNGFTYSGHPVACAAALKYLEIMDRDNINEHVR-EVGPYFMQRLA 371 Query: 363 ELNDHPLVGEVRGVGLLGAIE-LVQDKATRARYVGKGVGMICRQFCFDNGLIMRAVGDTM 421 EL P+VG+VRG+ L+ +E +V D V + V +FC + GLI+R + Sbjct: 372 ELKSFPIVGDVRGLCLMACVECVVSDDEDENIAVAQRVD----EFCQEKGLIVRPYENLC 427 Query: 422 IIAPPLVITKAEIDELVTKARKCLDLTLSAL 452 I++PPL+I K+ ID++V R + T+ + Sbjct: 428 ILSPPLIIDKSGIDQIVDILRDSIIATMDEI 458 Lambda K H 0.320 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 580 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 463 Length adjustment: 33 Effective length of query: 421 Effective length of database: 430 Effective search space: 181030 Effective search space used: 181030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory