Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_035242472.1 Q366_RS19250 aspartate aminotransferase family protein
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_000745975.1:WP_035242472.1 Length = 398 Score = 228 bits (581), Expect = 3e-64 Identities = 144/372 (38%), Positives = 209/372 (56%), Gaps = 20/372 (5%) Query: 76 LVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAA 135 L D QG + D L G + N+GH +P + +A+ Q S +A LAK L Sbjct: 29 LYDDQGNVYTDFLAGIAVCNLGHCHPDITAAISAQAGTLVHVSNLFYTRPQAELAKVLTE 88 Query: 136 LTPGKLKYSFFCNSGTESVEAALKLAKAY---QSPRGKFTFIATSGAFHGKSLGALSATA 192 + FF NSG E+ EAA+KLA+ + + G+F + +FHG+++ LSAT Sbjct: 89 KSFADRV--FFANSGAEANEAAIKLARRFFQAKGEAGRFKIVTMQQSFHGRTMATLSATG 146 Query: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252 + +K F PLL GF HVPF +IEA++ ++ V AV++EP+QGEGGVI P Sbjct: 147 QDKIKKGFFPLLDGFIHVPFNDIEALKAVMD------GTVCAVMMEPVQGEGGVIPADPE 200 Query: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312 Y+ AVR+LC + G L+I DE+QTGMGR G +FA E +V PDI+ LAKAL GV PIGA Sbjct: 201 YIKAVRQLCTDTGTLLIFDEIQTGMGRCGTLFAHESYDVVPDIMTLAKALANGV-PIGAM 259 Query: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372 +A+EE + L H +TFGG PLA AAAL + ++ EQ A +K L Sbjct: 260 LASEE--AALGFEVGSHGSTFGGTPLATAAALEVVRLISEQGFLASVREKSAYFLAQLNG 317 Query: 373 LAREYPDLVQEARGKGML--MAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPP 430 L ++ +V + RGKG+L M ++ + ++ SE F++ ++ + K +R PP Sbjct: 318 LKEKHKKVV-DVRGKGLLIGMELDISKGKTATDYVSECFKKGFIINAIQD--KVLRFAPP 374 Query: 431 LTL-TIEQCELV 441 L + T+E +LV Sbjct: 375 LIIGTVEINQLV 386 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 398 Length adjustment: 32 Effective length of query: 427 Effective length of database: 366 Effective search space: 156282 Effective search space used: 156282 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory