Align Putrescine aminotransferase; PAT; PATase; EC 2.6.1.82; Cadaverine transaminase; EC 2.6.1.-; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase (uncharacterized)
to candidate WP_245619834.1 Q366_RS00665 aspartate aminotransferase family protein
Query= curated2:B7LZM2 (459 letters) >NCBI__GCF_000745975.1:WP_245619834.1 Length = 423 Score = 221 bits (563), Expect = 4e-62 Identities = 128/388 (32%), Positives = 205/388 (52%), Gaps = 25/388 (6%) Query: 76 LVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLA---KQPLHSQELLDPLRAMLAKT 132 L D +G +++DCL + N GH +P + +A+ N L + + DPL L++ Sbjct: 45 LTDDKGNKYLDCLAAYSAANPGHHHPTITNALLNALTGNYASVISNVVFTDPLGIFLSEC 104 Query: 133 VA---ALTPGKLKYS---FFCNSGTESVEAALKLAKAYQSPR-----GKFTFIATSGAFH 181 A L PG + N G ESVE A+K + Y + G I + FH Sbjct: 105 AAFAPQLAPGFGAHGNKVLAKNGGVESVETAIKAMRYYGFKQKGIQDGNQEIIVFNNNFH 164 Query: 182 GKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQ 241 G+S+ +S ++ +R+ F PL PGF VPFG+++A++ A+ + +++EP+Q Sbjct: 165 GRSISVVSFSSSKKYREGFAPLTPGFVSVPFGDLDAVKKAVTP------NTCGILVEPLQ 218 Query: 242 GEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKA 301 GEGG+++PP G+L +R L DE ++ DE+Q GMGRTGK F EHE + PD L L KA Sbjct: 219 GEGGMVIPPKGFLKGLRALADENNLFLVCDEIQVGMGRTGKRFCFEHEGIVPDGLILGKA 278 Query: 302 LGGGVMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQ 361 L GG++P+ + + ++F +TFGG PLAC A +A + V E+ L Q+ + Sbjct: 279 LSGGLVPLSVFMTNAGIMDMIFSKG-SDGSTFGGYPLACVAGIAALKVFQEEKLDEQSAE 337 Query: 362 KGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNN 421 KG L + R P V+E RG G+ + IE D F ++ ++ ++V ++ Sbjct: 338 KGARLKKRIEDIGRRSPH-VKEVRGLGLFIGIEVKDAN-AMEFCRKLMKEGLIVND--SH 393 Query: 422 AKTIRIEPPLTLTIEQCELVIKAAHKAL 449 TIRI PPL + E+ + +++ + L Sbjct: 394 GHTIRISPPLVINDEEMDFMVERLERVL 421 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 423 Length adjustment: 32 Effective length of query: 427 Effective length of database: 391 Effective search space: 166957 Effective search space used: 166957 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory