Align phosphate acetyltransferase; EC 2.3.1.8 (characterized)
to candidate WP_035237809.1 Q366_RS07670 phosphate acyltransferase
Query= CharProtDB::CH_090885 (294 letters) >NCBI__GCF_000745975.1:WP_035237809.1 Length = 821 Score = 151 bits (381), Expect = 6e-41 Identities = 103/288 (35%), Positives = 164/288 (56%), Gaps = 18/288 (6%) Query: 17 LAVAAANDDHVIEAVYRAWRE---RVCEPVLFGPEEEITRIIEE--LVPEWKNPQIIDC- 70 +A+ AN++ I+A RA E R+ + VL G +EI+++ E LV + N I D Sbjct: 529 IAIVGANNEEAIQAAKRANEEGRFRISKFVLLGDFQEISQMAYEYDLVIDNDNYTIFDTE 588 Query: 71 -PPEEAGRLAVEAVSKGECDFLMKGKIKTGDLMK---IYLDERYGLRTGKTMAMVSVMEI 126 P EEA V + +G+ D LMKG I T D+++ YL L+ G+ M+ ++++I Sbjct: 589 NPVEEA----VNLLDEGKVDILMKGSIHTEDILRGFFKYLKASGRLQKGQVMSHTAIVDI 644 Query: 127 PDFPRPLIISDPGMLISPTLEQKVDMIEHCVRVANVMGLETPKVAVVGAIEVVNPKMPIT 186 P + L SD + P E++V ++E+ ++V + + ++ PKVAVV A+E VN + + Sbjct: 645 PTRNKLLAFSDGALNTYPDEEKRVAILENALKVVHNLNIKVPKVAVVSAVENVNRSVDSS 704 Query: 187 MEAA-ILSKMNQRGQIKGCIVDGPFALDNVVSEEAAKKKGIQSPVAGKADILILPDIEAA 245 +EA I ++ R CIV+GP +LD + AK+K + G AD+LILPDI++ Sbjct: 705 IEAERIAARFADRDD---CIVEGPLSLDVAMDPAIAKEKHYTGRIQGNADVLILPDIDSG 761 Query: 246 NILYKALVFLAKAKSASTILGGKVPVVLTSRADSEETKFYSIALSAVF 293 NIL+K L + A A IL G +P++LTSR DS +K S++L+ F Sbjct: 762 NILWKTLTTQSGAALAGVILCGDMPLILTSRGDSTRSKLASLSLAIKF 809 Lambda K H 0.319 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 28 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 821 Length adjustment: 34 Effective length of query: 260 Effective length of database: 787 Effective search space: 204620 Effective search space used: 204620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory