Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase; Vegetative protein 43; VEG43 (uncharacterized)
to candidate WP_035240680.1 Q366_RS15630 NADP-dependent malic enzyme
Query= curated2:P39646 (323 letters) >NCBI__GCF_000745975.1:WP_035240680.1 Length = 754 Score = 232 bits (592), Expect = 2e-65 Identities = 126/322 (39%), Positives = 195/322 (60%), Gaps = 2/322 (0%) Query: 3 DLFSTVQEKVAGKDVKIVFPEGLDERILEAVSKLAGNKVLNPIVIGNENEIQAKAKELNL 62 ++ T+ K ++VFPEG +++IL +V L K+ PI+IG++ I+ KA+ LN+ Sbjct: 426 EIMRTMINKAKTAPKRVVFPEGEEDKILRSVQVLLDEKIAIPILIGDDEIIREKARALNV 485 Query: 63 TLGGVKIYDPHTYEGMEDLVQA-FVERRKGKATEEQARKALLDE-NYFGTMLVYKGLADG 120 L +I P E ++ + F +R++ T AR+ L ++ NYFG ++V +G AD Sbjct: 486 DLRTTEIITPRKSEKLKAYTEILFAKRQRKGMTRYDARRRLQEDGNYFGAIMVEQGDADA 545 Query: 121 LVSGAAHSTADTVRPALQIIKTKEGVKKTSGVFIMARGEEQYVFADCAINIAPDSQDLAE 180 L+SG D + PA+++I K+G+ K G+++M ++ AD + I P +++LAE Sbjct: 546 LLSGINAHYPDVILPAIEVIGKKDGLSKVHGLYMMVFKKKVIFCADTTVTIEPTAEELAE 605 Query: 181 IAIESANTAKMFDIEPRVAMLSFSTKGSAKSDETEKVADAVKIAKEKAPELTLDGEFQFD 240 AI +A A+ FDI PRVAMLSFS GSA+ T KV A ++ KE APEL +DGE Q + Sbjct: 606 TAILAAEQAQHFDITPRVAMLSFSNFGSAQHPLTLKVKKATELVKEWAPELRVDGEIQAN 665 Query: 241 AAFVPSVAEKKAPDSEIKGDANVFVFPSLEAGNIGYKIAQRLGNFEAVGPILQGLNMPVN 300 A P + + + P S +KGDAN+F+FP L++GNI YK+ +LGN AVGPIL G+ P++ Sbjct: 666 VALDPEIVKNQYPFSNLKGDANIFIFPDLQSGNITYKMLAKLGNAVAVGPILMGMKKPIH 725 Query: 301 DLSRGCNAEDVYNLALITAAQA 322 L R + D+ N+A + A Sbjct: 726 VLQRADDVSDIVNMAAVAVNDA 747 Lambda K H 0.314 0.132 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 534 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 754 Length adjustment: 34 Effective length of query: 289 Effective length of database: 720 Effective search space: 208080 Effective search space used: 208080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory