Align L-fuculose phosphate aldolase (EC 4.1.2.17) (characterized)
to candidate WP_035241760.1 Q366_RS17895 L-fuculose-phosphate aldolase
Query= reanno::Koxy:BWI76_RS22915 (215 letters) >NCBI__GCF_000745975.1:WP_035241760.1 Length = 219 Score = 152 bits (383), Expect = 6e-42 Identities = 86/213 (40%), Positives = 126/213 (59%), Gaps = 5/213 (2%) Query: 1 MERNRLARQIIDTCLEMTRLGLNQGTAGNVSV--RYQGGMLITPTGIPYEKLTEAHIVYI 58 ME + ++ L+M GL GT GN+S+ R G + ++P+GI Y L +V Sbjct: 1 MELENERKAVVRFGLKMVESGLTTGTGGNLSIIDRKSGTVAVSPSGIEYAVLQPRDVVLT 60 Query: 59 DAEGQHEQGKL-PSSEWRFHLAAYQTRPDAHAVVHNHAVHCTAVSILNRPIPAIHYMIAA 117 D +G G+ PSSE FHL+ Y R D A+VH H+ + ++ L IPA+HY++ Sbjct: 61 DMQGNVIDGEARPSSELGFHLSLYGQRKDIQAIVHTHSPYAVTMACLGWEIPAVHYLVGF 120 Query: 118 AGGNSIPCAPYATFGTRELSEHVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVL 177 AG +P APYATFGT EL++ VA + + A LL +HGL+A +++ A A E+E + Sbjct: 121 AG-KKVPLAPYATFGTPELAQIVAEYIGDYNALLLANHGLVAVGSSMDTAFAAAEEIEFV 179 Query: 178 AQLYLSTLAIIDPVPVLDDEAIAVVLEKFKTYG 210 A++Y T +I +PV +L DE + VLEKFKTYG Sbjct: 180 ARIYYQTKSIGNPV-ILPDEEMNTVLEKFKTYG 211 Lambda K H 0.320 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 219 Length adjustment: 22 Effective length of query: 193 Effective length of database: 197 Effective search space: 38021 Effective search space used: 38021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory