Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_035236781.1 Q366_RS04640 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_000745975.1:WP_035236781.1 Length = 248 Score = 202 bits (515), Expect = 4e-57 Identities = 109/241 (45%), Positives = 156/241 (64%), Gaps = 6/241 (2%) Query: 11 LLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKIT 70 +L+++N+ Y ++ ++ V+ V GEL+++IG NGAGKSTL + GLL +G+I Sbjct: 1 MLKIKNLKCCY-GNIAVVHTVSLSVRQGELISIIGANGAGKSTLLGAVCGLLKNWSGEIE 59 Query: 71 FKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIR-----NDSLQPLKDK 125 FKG+++ G+ + IV G+ VP+ +F LSV +NL+MGA+ R + D+ Sbjct: 60 FKGRSLKGMSAPAIVSQGISMVPEGRQIFSPLSVMDNLKMGAYTRFRKEGKTRVAQDLDR 119 Query: 126 IFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQ 185 + MFP L +R Q AGTLSGGE+QMLA+G+ALM P+LLVLDEPS L+P +V +FE Sbjct: 120 VVQMFPILRERSDQLAGTLSGGEQQMLAIGRALMARPALLVLDEPSMGLAPKIVGMIFET 179 Query: 186 VKQINQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYLGAGK 245 ++ + G I+LVEQNAR AL++ADRGYVLE+G+ + G ELL D V YLG Sbjct: 180 IQTLRDTGVTILLVEQNARAALKIADRGYVLETGKMVLQGSADELLVDDDVKRAYLGKDY 239 Query: 246 G 246 G Sbjct: 240 G 240 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 248 Length adjustment: 24 Effective length of query: 223 Effective length of database: 224 Effective search space: 49952 Effective search space used: 49952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory