Align High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized)
to candidate WP_084691833.1 Q366_RS13530 branched-chain amino acid ABC transporter permease
Query= SwissProt::P22729 (425 letters) >NCBI__GCF_000745975.1:WP_084691833.1 Length = 368 Score = 150 bits (378), Expect = 8e-41 Identities = 111/346 (32%), Positives = 182/346 (52%), Gaps = 36/346 (10%) Query: 90 KLFLVALLVLAVAWPFMVSRGT-VDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAI 148 K+ L A+L+L +A P ++S T + I L Y L N+V G +G+L LG+ F I Sbjct: 39 KVLLGAVLILMLALPAVISSPTWLHIIVLIFFYAYLTTSWNMVGGFAGVLPLGHAVFLGI 98 Query: 149 GAYTFALLNHYYGLGFWTCLPIAGLMAAAAGFLLGFPVLRLRGDYLAIVTLGFGEIVRIL 208 GAYT +L+ YG+ W + + G++A AAG ++G P L++RG Y A+ T+ F E VR+ Sbjct: 99 GAYTSTVLSLQYGISPWLGMFVGGVLAVAAGMVIGLPTLKMRGAYFALATIAFSEGVRV- 157 Query: 209 LLNNTEITG-----GPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLKYDPSDRVIF 263 ++ N E G GP G+ QIP + GW F S +V + Sbjct: 158 MVENIEYLGPFKLNGPRGL-QIPPLNI------------GWANFMF--------SSKVPY 196 Query: 264 LYLVALLLVVLSLFVINRLLRMPLGRAWEALREDEIACRSLGLSPRRIKLTAFTISAAFA 323 Y++ +L+++ LF+ + R LG A E+ A ++LG++ R K+ A +S F Sbjct: 197 YYIILAMLLII-LFLTWVVSRSKLGYYLTAGGEEPEAAQALGVNVSRAKVIAMALSCFFT 255 Query: 324 GFAGTLFAARQGFVSPESFTFAESAFVLA-IVVLGGMGSQFAVILAAILLVVSRELMRDF 382 AGT +A F+ P+S + +F +A I ++GG GS +L A+LL +L R + Sbjct: 256 ALAGTFYAQFSLFIHPKSTISLDISFEIAFIALIGGRGSIAGPVLGALLLRPVSDLSRIY 315 Query: 383 -----NEYSMLMLGGLMVLMMIWRPQGLL-PMTRPQLKLKNGAAKG 422 +++ G +++L+MI++P+GL P+TR ++ N A G Sbjct: 316 FGDILPGMHLVIYGVVLILVMIYQPRGLQEPLTRIYDRVINRMADG 361 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 368 Length adjustment: 31 Effective length of query: 394 Effective length of database: 337 Effective search space: 132778 Effective search space used: 132778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory