Align glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate WP_035238778.1 Q366_RS10385 aldehyde dehydrogenase family protein
Query= BRENDA::Q88RC0 (480 letters) >NCBI__GCF_000745975.1:WP_035238778.1 Length = 491 Score = 310 bits (794), Expect = 7e-89 Identities = 177/478 (37%), Positives = 262/478 (54%), Gaps = 9/478 (1%) Query: 10 RQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPKMGTAETRRAIEAADKALPAWRALTA 69 R YI+G+W+DA G+T VT PA GE + T G + A++AA KA W ++ Sbjct: 8 RYNLYIDGKWVDAKEGKTFTVTCPANGEFLSTCANAGAEDVDLAVKAARKAFKTWSQVSP 67 Query: 70 KERSAKLRRWFELMIENQDDLARLMTTEQGKPLAEAKG-EIAYAASFIEWFAEEAKRIYG 128 +ER+ L + +L+ E + LA + T + GKP+ E + ++ A+ +FA + G Sbjct: 68 QERAGLLLKIADLIDEKAEHLAMVETLDNGKPIRETRNIDVPLASDHFRYFAGAVRTEEG 127 Query: 129 DTIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPYS 188 T IV+ +PIGV I PWNFP M K PALAAG T+V+KP+S T S Sbjct: 128 -TCTMIDDKTMSIVLSEPIGVIGQIIPWNFPFLMAAWKIAPALAAGNTVVMKPSSDTSLS 186 Query: 189 ALALVELAHRAGIPAGVLSVVTGSAGEVGGELTGNSLVRKLSFTGSTEIGRQLMEECAKD 248 L ++ +P GV++VVTG G + + KL+FTGSTE+G Q+ + AK Sbjct: 187 LLEFAKILDTV-LPPGVVNVVTGGGSSTGNAMLNHEGFAKLAFTGSTEVGYQIADAAAKK 245 Query: 249 IKKVSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRIYVQDGVYDAFAEK 308 + +LELGG + I F D DKAVEG ++ N GQ C +R++V + +YD F + Sbjct: 246 LIPATLELGGKSANIYFPDCPWDKAVEGVLLGILFNQGQVCCAGSRVFVHEDIYDKFLAE 305 Query: 309 LAAAVAKLKIGNGLEEGTTTGPLIDGKAVAKVQEHIEDAVSKGAKVLSG------GKLIE 362 + A +K+G EE T G I+ + K+ + + +GA V++G G+L + Sbjct: 306 IKARFESVKVGLPWEEDTMMGAQINLRQAEKILDCVAAGKKEGATVVTGGEKINQGELAK 365 Query: 363 GNFFEPTILVDVPKTAAVAKEETFGPLAPLFRFKDEAEVIAMSNDTEFGLASYFYARDMS 422 G F +PTIL DV + VA+EE FGP+ + +FKDE EVI M+ND +GL + +D++ Sbjct: 366 GCFLKPTILADVDNSMTVAQEEIFGPVVCVIKFKDEQEVIDMANDNIYGLGGAVWTKDIN 425 Query: 423 RVFRVAEALEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYLCISV 480 R RVA A+ G + +NT PFGG K SG+GRE K + Y + K + IS+ Sbjct: 426 RALRVARAVRTGRMWVNTYNQLPAHTPFGGYKKSGIGRETHKMMLAHYSQSKNIYISM 483 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 588 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 491 Length adjustment: 34 Effective length of query: 446 Effective length of database: 457 Effective search space: 203822 Effective search space used: 203822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory