Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_035238778.1 Q366_RS10385 aldehyde dehydrogenase family protein
Query= BRENDA::P77674 (474 letters) >NCBI__GCF_000745975.1:WP_035238778.1 Length = 491 Score = 327 bits (837), Expect = 7e-94 Identities = 182/477 (38%), Positives = 270/477 (56%), Gaps = 9/477 (1%) Query: 2 QHKLLINGELVSG-EGEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTP 60 ++ L I+G+ V EG+ V PA G+ L A A AE VD AV+AA AF W Q +P Sbjct: 8 RYNLYIDGKWVDAKEGKTFTVTCPANGEFLSTCANAGAEDVDLAVKAARKAFKTWSQVSP 67 Query: 61 KVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNG 120 + RA LLK+AD+I+E + A +E+ + GKP+ N ++P D FR+FAGA R G Sbjct: 68 QERAGLLLKIADLIDEKAEHLAMVETLDNGKPIRETRNIDVPLASDHFRYFAGAVRTEEG 127 Query: 121 LAAGEYLEGHT-SMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPL 179 ++ T S++ +P+GV+ I PWN+P +MAAWK+APALAAGN VV+KPS T L Sbjct: 128 TCT--MIDDKTMSIVLSEPIGVIGQIIPWNFPFLMAAWKIAPALAAGNTVVMKPSSDTSL 185 Query: 180 TALKLAELAKDIFPAGVINILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASS 239 + L+ A++ + P GV+N++ G G + G+ + H ++ TGS G I A Sbjct: 186 SLLEFAKILDTVLPPGVVNVVTGGGSSTGNAMLNHEGFAKLAFTGSTEVGYQIADAAAKK 245 Query: 240 IKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEK 299 + +ELGGK+ I F D + VEGV +N GQ C A R++ + IYD + + Sbjct: 246 LIPATLELGGKSANIYFPDCPWDKAVEGVLLGILFNQGQVCCAGSRVFVHEDIYDKFLAE 305 Query: 300 LGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEK----RKG 355 + A ++K G P +E T +G +L E++ V K G V+TGGEK Sbjct: 306 IKARFESVKVGLPWEEDTMMGAQINLRQAEKILDCVAAGKKEG-ATVVTGGEKINQGELA 364 Query: 356 NGYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDV 415 G + PT+LA + Q+E+FGPVV V F +E++V++ AND+ YGL +VWTKD+ Sbjct: 365 KGCFLKPTILADVDNSMTVAQEEIFGPVVCVIKFKDEQEVIDMANDNIYGLGGAVWTKDI 424 Query: 416 GRAHRVSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMV 472 RA RV+ ++ G WVNT+ L + P GG K SG G++ L Y+ +++ + Sbjct: 425 NRALRVARAVRTGRMWVNTYNQLPAHTPFGGYKKSGIGRETHKMMLAHYSQSKNIYI 481 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 559 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 491 Length adjustment: 34 Effective length of query: 440 Effective length of database: 457 Effective search space: 201080 Effective search space used: 201080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory