Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_035238989.1 Q366_RS11450 acyl-CoA dehydrogenase
Query= BRENDA::Q3JP94 (395 letters) >NCBI__GCF_000745975.1:WP_035238989.1 Length = 384 Score = 209 bits (531), Expect = 1e-58 Identities = 131/373 (35%), Positives = 201/373 (53%), Gaps = 2/373 (0%) Query: 17 QLADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGGPG 76 +L D++ M+++ +++ +AP E + A F++MGE+GL+G +PE YGG Sbjct: 4 KLTDEQVMIQNMVREFSRKVVAPTAAERDKTTAFPAENFKQMGELGLMGMMVPEAYGGEA 63 Query: 77 LDYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIGCF 136 D VSY L E+ + +MSVQ+S+V + +FG++ QK+++L LA+GE +G F Sbjct: 64 ADAVSYVLALSEIAYSCASTSVVMSVQNSIVCESLNKFGTEEQKQEFLVPLASGEILGAF 123 Query: 137 GLTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLDED-GRDEIRG 195 LTEP+ GSDP S T A K Y ++G+K +IT+ + V +V AK DE G I Sbjct: 124 ALTEPDAGSDPVSQATTAIKDGDEYVINGTKRFITSGENSSVVLVTAKTDETLGHRGISC 183 Query: 196 FILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENIL-PHVKGLRGPFTCLNSAR 254 FI+ K GL K+GLRAS T +++ ++ VP NIL G + + L+S R Sbjct: 184 FIVPKTTAGLIVGHHEDKMGLRASDTTDLIFEDCRVPAANILGKEGDGFKIAMSGLDSGR 243 Query: 255 YGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLRLG 314 GIA +LG A++ + A +Y RKQFG + +Q I+ ++ADM T+I Q L Sbjct: 244 IGIAAQSLGVAQAAFDAAIKYARGRKQFGVAITKHQAIRFQIADMATKIEAARQLTLSAA 303 Query: 315 RMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYE 374 MKD G S+ K + DI A + GG G + ++ V R + V YE Sbjct: 304 SMKDRGERFTREASMAKLFASEMVQDITAQAIQIHGGYGFTKDYAVERFYRDARVFTIYE 363 Query: 375 GTHDIHALILGRA 387 GT +I +++ A Sbjct: 364 GTSEIQRIVISNA 376 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 384 Length adjustment: 30 Effective length of query: 365 Effective length of database: 354 Effective search space: 129210 Effective search space used: 129210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory