Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_051957728.1 Q366_RS00595 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_000745975.1:WP_051957728.1 Length = 240 Score = 155 bits (392), Expect = 7e-43 Identities = 91/236 (38%), Positives = 146/236 (61%), Gaps = 6/236 (2%) Query: 5 ILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHI 64 IL+++ + YG ++G+ + V E E V++IG NGAGKTTTL++I G P G+I Sbjct: 7 ILEIEDMQTYYGDSHVIQGLSMHVYEQEAVSIIGRNGAGKTTTLRSIMGLTPPR--SGNI 64 Query: 65 EYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADIDKWF 124 G+ + ++ + +A VP R +F +S++ENL + A G+ A +K Sbjct: 65 YIDGRQTTRWQPHKISRLGVAYVPAERHIFPGLSVEENLRLAARPGS--GENAWTYEKVC 122 Query: 125 AVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIR 184 FP L +R+ Q TLSGG+QQ LA+ RAL+S+P+++++DEPS GLSPI+V+ I +V+ Sbjct: 123 GHFPVLADRSHQDGATLSGGQQQTLAIGRALISNPRIIIMDEPSQGLSPILVQTITDVVL 182 Query: 185 NVSAQ-GITILLVEQNAKLALEAAHRGYVMES-GLITMQGQAQQMLDDPRVKAAYL 238 Q GIT+L+VEQN ++AL+ A R Y+M++ G I +Q+ D+P + ++L Sbjct: 183 KFCVQSGITLLIVEQNYQMALKVADRHYLMDTRGEIVNNLTTRQLEDNPEIIQSHL 238 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 240 Length adjustment: 23 Effective length of query: 218 Effective length of database: 217 Effective search space: 47306 Effective search space used: 47306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory