Align Proline dehydrogenase 1; PRODH 1; Proline oxidase 1; EC 1.5.5.2 (characterized)
to candidate WP_035236837.1 Q366_RS04815 proline dehydrogenase family protein
Query= SwissProt::O32179 (302 letters) >NCBI__GCF_000745975.1:WP_035236837.1 Length = 303 Score = 195 bits (495), Expect = 1e-54 Identities = 99/281 (35%), Positives = 163/281 (58%), Gaps = 6/281 (2%) Query: 28 ARRFVAGDTIESAVKTVKRLNRSGLCATIDYLGEYAASEKEANQVAEECKKAIQAIAEHQ 87 ++ ++AG T + A+ K LNR + T+D LGE+ + +A + ++ I+ I Sbjct: 22 SKSYIAGTTTQDAINASKALNRENVMVTLDILGEFIKTMSQAAKNRDDYLALIRTIEAAA 81 Query: 88 LNSELSLKLTSIGLDLSEELALTHLRAILSVAKQYDVAVTIDMEDYSHYEQTLSIYRQCK 147 +N SLK + GL + ++ ++R + + A + V IDMED + ++ I+R+ K Sbjct: 82 INGNYSLKPSMFGLLIDKKTCFEYMRELTAEAASHGNFVRIDMEDSPCVDDSIDIFRRLK 141 Query: 148 QEFEK-LGTVIQAYLYRAAEDIRKMRDLKP-----NLRLVKGAYKESAAVAFPDKRGTDL 201 QEF + +G V+QAYL R + D+ M DL+ N RLVKG Y E AA+A+ + + Sbjct: 142 QEFPRNIGLVLQAYLKRTSGDLESMLDLRRDDADLNFRLVKGVYVEPAAIAYKAYKDINA 201 Query: 202 HFQSLIKLQLLSGNYTAVATHDDDIIAFTKQLVAEHQIPASQFEFQMLYGIRPERQKELA 261 H+ ++ + Y A+ATHD +I L+ ++Q+P ++EFQMLYG+ P++++EL Sbjct: 202 HYLEDLEFMFKNNVYAAIATHDTPLIQGALDLIDQYQVPKEKYEFQMLYGVTPKKRRELV 261 Query: 262 KEGYRMRVYVPYGTDWFSYFMRRIAERPANAAFVLKGILKK 302 + G+RMRVYVP+G WF Y RR+ E PA +LK ++ K Sbjct: 262 QNGHRMRVYVPFGEQWFGYSTRRLKENPAMVRHILKALVDK 302 Lambda K H 0.321 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 303 Length adjustment: 27 Effective length of query: 275 Effective length of database: 276 Effective search space: 75900 Effective search space used: 75900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory