Align aminomuconate-semialdehyde dehydrogenase (EC 1.2.1.32) (characterized)
to candidate WP_035241269.1 Q366_RS17050 NADP-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::Q83XU8 (485 letters) >NCBI__GCF_000745975.1:WP_035241269.1 Length = 485 Score = 285 bits (728), Expect = 3e-81 Identities = 168/462 (36%), Positives = 255/462 (55%), Gaps = 13/462 (2%) Query: 23 SSPLNNAVIAKVHEAGRAEVDAAVAAAQAALKGAWGRMSLAQRVEVLYAVADGINRRFDD 82 ++P V+ V G E A+ AA +L AW + AQR +L D + +D Sbjct: 32 TNPATGEVLGTVPFCGADETRRAIDAANGSLP-AWRSKTAAQRSAILRRWHDLLMENQED 90 Query: 83 FLAAEVEDTGKPMSLARHVDIPRGAANFKIFADVVKNVPTEFFEMPTPDGVGAINYAV-R 141 + GKP++ +R +I A+ F+ FA+ K + + P + + V + Sbjct: 91 LALLMTAEQGKPLAESRG-EIAYAASFFEWFAEEAKRIYGDII----PQTIASQRLVVIK 145 Query: 142 RPVGVVGVICPWNLPLLLMTWKVGPALACGNTVVVKPSEETPQTAALLGEVMNTAGVPPG 201 +PVGVV I PWN P ++T K G ALA G T+VVKP+ TP +A + ++ AG+PPG Sbjct: 146 QPVGVVAAITPWNFPSAMITRKAGAALAAGCTMVVKPATATPFSALAIAKLAQEAGMPPG 205 Query: 202 VYNVVHGFGPNSTGEFLTSHPDVNAITFTGETGTGEAIMKAAADGARPVSLELGGKNAAI 261 V+NVV G GE LT++P V +TFTG T G+ +M+ A + VS+ELGG I Sbjct: 206 VFNVVTGSSSAIGGE-LTANPIVRKLTFTGSTEVGKKLMQDCAGTMKRVSMELGGNAPFI 264 Query: 262 VFADCDLDKAIEGTLRSCFANCGQVCLGTERVYVERPIFDRFVSRLKKGAEGMQLGRPED 321 VF D DLD A+EG L + N GQ C+ R+YV+ ++D+F +L + +++G + Sbjct: 265 VFDDADLDAAVEGALSCKYRNSGQTCVCANRLYVQAGVYDQFCEKLARAVATLKVGNGIE 324 Query: 322 LATGMGPLISQEHREKVLSYYKKAVEAGATVVTGGGVPEMPEALKGGAWVQPTIWTGLGD 381 GPLI + E V + A++ GA V+ GG + GG + PT+ + D Sbjct: 325 EGVVQGPLIDMKAVESVERHINDALDKGAKVLAGGKRHAL-----GGTFFSPTVLADVTD 379 Query: 382 DSVVAREEIFGPCALVMPFDSEEEVIRRANDNDYGLARRIWTTNLSRAHRVAGAIEVGIA 441 D +VA+EEIFGP A + F+SE EV+++AND +YGLA +T +++R RV +E G+ Sbjct: 380 DMLVAKEEIFGPFAPIFKFESEAEVVQKANDTEYGLAAYFFTRDMARTWRVGEKLEYGLI 439 Query: 442 WVNSWFLRDLRTAFGGSKQSGIGREGGVHSLEFYTELKNVCI 483 +NS + + FGG K+SG GREG + L+ Y E+K +C+ Sbjct: 440 GINSGIISNAVAPFGGVKESGNGREGSKYGLDDYLEIKYMCM 481 Lambda K H 0.318 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 524 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 485 Length adjustment: 34 Effective length of query: 451 Effective length of database: 451 Effective search space: 203401 Effective search space used: 203401 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory