Align Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized)
to candidate WP_035238683.1 Q366_RS10330 acetyl-CoA C-acyltransferase
Query= SwissProt::Q8VPF1 (401 letters) >NCBI__GCF_000745975.1:WP_035238683.1 Length = 416 Score = 259 bits (663), Expect = 8e-74 Identities = 162/421 (38%), Positives = 232/421 (55%), Gaps = 32/421 (7%) Query: 3 REVYICDAVRTPIGRFGGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQAG 62 ++V I A RT IG FGG+L + LA++ +K ++R +D + +D+V G + Sbjct: 2 KDVVIVSACRTAIGAFGGTLKDLNGACLASITMKEAIKR-AGIDPAIIDDVRYGTCLEH- 59 Query: 63 EDNRNVARMALLLAGLPDSVPGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVESMS 122 D N AR+ L+AG+PD+VP T+NR+C SGM+AV + I +G A +++AGG E MS Sbjct: 60 HDTLNTARVGALMAGIPDTVPAATINRVCISGMEAVLSGMAMIQAGMAHVILAGGTEHMS 119 Query: 123 RAPYVMGKADSAFGRGQKIEDTTIGWRFINPLMKAQYGVD-------------------- 162 PY + KA G +++D I+ L Y + Sbjct: 120 GVPYTVPKARW----GCRLQDANFVDALIHALHCGSYTLPFDETSPVDTTQAPASYFLGK 175 Query: 163 --AMPETADNVADDYKVSRADQDAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKGETVV 220 M TA+ A +SR + D ALRS A RA G FA+EIVPV + +K + ++ Sbjct: 176 PYIMGHTAEFTAQLLDISREEMDEVALRSHNNAERATNDGSFADEIVPVEVPRRKKDPII 235 Query: 221 -DADEHLRPDTTLEALAKLKPVNGPDK-TVTAGNASGVNDGSVALILASAEAVKKHGLKA 278 D DEH RP TLE LA L P P VTAGNASG+NDGS +++ SAE K+ GL Sbjct: 236 FDEDEHFRPGMTLEKLAALPPAFIPKTGKVTAGNASGINDGSTGMVIMSAEKAKELGLTP 295 Query: 279 RAKVLGMASAGVAPRVMGIGPVPAVRKLLERLNLSVADFDVIELNEAFAAQGLAVTRELG 338 AK+ P VMG+ PVPAV+ L+ + +++ DFD+IE+NEAFAAQ L +EL Sbjct: 296 IAKIKATGMGACHPSVMGLSPVPAVKDLMAKSGITIDDFDLIEVNEAFAAQYLGCEKELN 355 Query: 339 IADDDARVNPNGGAIALGHPLGASGARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAV 398 + + N NG I LGHP+GA+GAR++ T ++ ++ GL T+C G G +A A+ Sbjct: 356 L--NREITNINGSGIGLGHPIGATGARVMTTLMYAMKNKRKNLGLATLCGGGGVSMACAI 413 Query: 399 E 399 E Sbjct: 414 E 414 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 401 Length of database: 416 Length adjustment: 31 Effective length of query: 370 Effective length of database: 385 Effective search space: 142450 Effective search space used: 142450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory