Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate WP_035241269.1 Q366_RS17050 NADP-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::P42412 (487 letters) >NCBI__GCF_000745975.1:WP_035241269.1 Length = 485 Score = 236 bits (603), Expect = 1e-66 Identities = 141/467 (30%), Positives = 237/467 (50%), Gaps = 5/467 (1%) Query: 10 YINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRA 69 +I +W+E+ + + V NPAT EVL VP ++ A A + W +R+ Sbjct: 15 FIQDQWIEADSKKNVAVTNPATGEVLGTVPFCGADETRRAIDAANGSLPAWRSKTAAQRS 74 Query: 70 RILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLAS 129 IL + LL +++E+LA L+T E GK E+ GE+ E+ A + GD + Sbjct: 75 AILRRWHDLLMENQEDLALLMTAEQGKPLAESRGEIAYAASFFEWFAEEAKRIYGDIIPQ 134 Query: 130 IATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLV 189 + P+GVV I P+NFP + A+A G T ++KP+ TP + Sbjct: 135 TIASQRLVVIKQPVGVVAAITPWNFPSAMITRKAGAALAAGCTMVVKPATATPFSALAIA 194 Query: 190 ELFEKAGLPKGVFNVVYGAHDVVNG-ILEHPEIKAISFVGSKPVGEYVYKKGSENLKRVQ 248 +L ++AG+P GVFNVV G+ + G + +P ++ ++F GS VG+ + + + +KRV Sbjct: 195 KLAQEAGMPPGVFNVVTGSSSAIGGELTANPIVRKLTFTGSTEVGKKLMQDCAGTMKRVS 254 Query: 249 SLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKV 308 G IV +DA+L+ V + + ++G+ C+ + V+ G+ D+F KL V Sbjct: 255 MELGGNAPFIVFDDADLDAAVEGALSCKYRNSGQTCVCANRLYVQAGVYDQFCEKLARAV 314 Query: 309 ADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVSDDGYFVGPTI 368 A +K+GNG+++GV GP+I + +I L++GA+++ G+ + G F PT+ Sbjct: 315 ATLKVGNGIEEGVVQGPLIDMKAVESVERHINDALDKGAKVLAGGKRHAL-GGTFFSPTV 373 Query: 369 FDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYFREN 428 +VT +M + K+EIF P + + ++ E ++ AN +E+ A FT + E Sbjct: 374 LADVTDDMLVAKEEIFGPFAPIFKFESEAEVVQKANDTEYGLAAYFFTRDMARTWRVGEK 433 Query: 429 IDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRKK 475 ++ G++GIN G+ A PF G K S G K +D Y K Sbjct: 434 LEYGLIGINSGI-ISNAVAPFGGVKES--GNGREGSKYGLDDYLEIK 477 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 485 Length adjustment: 34 Effective length of query: 453 Effective length of database: 451 Effective search space: 204303 Effective search space used: 204303 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory