GapMind for catabolism of small carbon sources

 

Protein WP_036260788.1 in Methylocapsa aurea KYG

Annotation: NCBI__GCF_000746085.1:WP_036260788.1

Length: 308 amino acids

Source: GCF_000746085.1 in NCBI

Candidate for 26 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 58% 118.2 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
D-glucose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 58% 118.2 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
lactose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 58% 118.2 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
D-maltose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 58% 118.2 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
sucrose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 58% 118.2 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
trehalose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 58% 118.2 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
D-xylose catabolism xylG lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 58% 118.2 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
D-ribose catabolism rbsA lo Ribose ABC transporter ATPase; SubName: Full=Sugar ABC transporter ATP-binding protein; SubName: Full=Sugar ABC transporter ATPase (characterized, see rationale) 32% 55% 111.7 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
D-fructose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 32% 88% 106.7 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 32% 88% 106.7 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 32% 88% 106.7 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
sucrose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 32% 88% 106.7 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-isoleucine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 32% 92% 104.4 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-leucine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 32% 92% 104.4 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-phenylalanine catabolism livF lo ABC transporter ATP-binding protein (characterized, see rationale) 32% 92% 104.4 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-proline catabolism HSERO_RS00900 lo ABC transporter ATP-binding protein (characterized, see rationale) 32% 92% 104.4 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-serine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 32% 92% 104.4 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-tyrosine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 32% 92% 104.4 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
D-lactate catabolism PGA1_c12640 lo D-lactate transporter, ATP-binding component (characterized) 31% 92% 103.6 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
myo-inositol catabolism PS417_11890 lo Inositol transport system ATP-binding protein (characterized) 30% 55% 102.4 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 31% 85% 99.4 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-valine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 30% 93% 98.6 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-arginine catabolism braF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 82% 87.8 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-glutamate catabolism braF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 82% 87.8 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-histidine catabolism braF lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 82% 87.8 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5
L-valine catabolism livG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 82% 87.8 uncharacterized ABC transporter ATP-binding protein yadG 44% 236.5

Sequence Analysis Tools

View WP_036260788.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MQPIISVSGLTKTYASGFEALKTINLEIRPGEIFALLGPNGAGKTTLINIICGIVNPSSG
VIRADGCDIVKDYRAARAKIGLVPQELSTNAFETVFAAVSFSRGLFGRPANPAYVEKVLR
DLSLWDKKDSMIMTLSGGMKRRVMIAKALSHEPKILFLDEPTAGVDVELRRDMWEMVRSL
RATGVTIILTTHYIEEAEEMADRIGVINKGEIILVEDKAALMNKLGKKQLILHLLDRLDA
IPDELAGYRLELSGNGSELVYTYDAKGEGTGIAPLMRRLSDLKIDFQDLQTSQSSLEEIF
VSLVRASP

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory