Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate WP_036257477.1 DL86_RS01770 enoyl-CoA hydratase/isomerase family protein
Query= reanno::psRCH2:GFF2389 (257 letters) >NCBI__GCF_000746085.1:WP_036257477.1 Length = 354 Score = 99.0 bits (245), Expect = 1e-25 Identities = 66/203 (32%), Positives = 100/203 (49%), Gaps = 14/203 (6%) Query: 13 RVALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAKAFAAGADIKEMAE 72 R +ITL+RP LNAL ++ E+ +AL E+DP + +++ + +AF AGADI+ + E Sbjct: 13 RCGVITLDRPNVLNALTLNMVREIARALDLWESDPAVQTVLIRAAGRAFCAGADIRNLYE 72 Query: 73 LTYPQIYLDDF------FADADRIATRRKPLIAAVAGYALGGGCELALLCDMIFAADNAR 126 L Y D + RI KP +A + G +GGG ++L I A D+ Sbjct: 73 LGRAGRYADQLAFWREEYCLNRRIKLYPKPYVALIDGIVMGGGAGVSLHGSHIVAGDDFN 132 Query: 127 FGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVARVFP----- 181 F PEV +G P +G T L R GK + + LTG +M +A + A P Sbjct: 133 FAMPEVGIGFFPDVGATFFLPRLPGKT-GVYLALTGARMTCGDALAFEVAAAYAPSARHA 191 Query: 182 --AESLLEETLKAARVIAEKSLP 202 A+ L+E +A + AE + P Sbjct: 192 ALAQRLIEGEDPSAAIAAESAPP 214 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 354 Length adjustment: 27 Effective length of query: 230 Effective length of database: 327 Effective search space: 75210 Effective search space used: 75210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory