Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate WP_036258924.1 DL86_RS05195 acetoacetyl-CoA reductase
Query= reanno::ANA3:7024897 (256 letters) >NCBI__GCF_000746085.1:WP_036258924.1 Length = 241 Score = 117 bits (292), Expect = 3e-31 Identities = 76/239 (31%), Positives = 118/239 (49%), Gaps = 9/239 (3%) Query: 17 ISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQPEASVTFYHCDLVDIA 76 +SGG+ GIGA + G KVA +E+ A+ K E + Y D+ + Sbjct: 7 VSGGSRGIGAAISKGLHAAGYKVAATYAGNDEAA---ANFKA---ETGIPVYKWDVSNYK 60 Query: 77 ALKRVIAQVEDDLGPISVLINNAACDQRHSIDEVTPEYWDQCLNTNLRHYFFAVQAVRPQ 136 + +V DDLGPI +LINNA + ++TPE W +NTNL F + V Sbjct: 61 ECAEGLKKVGDDLGPIEILINNAGITRDTMFHKMTPEQWFDVINTNLNSLFNMTRPVIEG 120 Query: 137 MQRLGGGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAADLGKDKIRINTLTPGWV 196 M+ G G ++N+ S++ Q G YTASKAG +G T+ LA + I +N + PG++ Sbjct: 121 MRERGFGRIVNISSINGQKGQMGQTNYTASKAGDIGFTKSLAQENAGKGITVNAVCPGYI 180 Query: 197 MTKRQLTHWVDKDT-AKHIENNQCIKEYVMPEDIAAMALFLAADDSKLCTAQNFIVDGG 254 T + V K+ K + ++ PE++A + +FL A++S T V+GG Sbjct: 181 AT--DMVKAVPKEVLEKSVLPLIPLRRLGEPEEVARVVVFLVAEESGFITGSTLSVNGG 237 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 241 Length adjustment: 24 Effective length of query: 232 Effective length of database: 217 Effective search space: 50344 Effective search space used: 50344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory