Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate WP_036261783.1 DL86_RS12180 3-hydroxybutyrate dehydrogenase
Query= reanno::pseudo5_N2C3_1:AO356_20240 (272 letters) >NCBI__GCF_000746085.1:WP_036261783.1 Length = 272 Score = 117 bits (292), Expect = 3e-31 Identities = 80/259 (30%), Positives = 120/259 (46%), Gaps = 9/259 (3%) Query: 15 KGERLKDKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAQKVEAVAAHWRERGADVHA 74 +GE L K ++TG+ GIG I A AS +V++ A E+ + Sbjct: 11 RGE-LAGKAAIVTGSTSGIGLGIARALASAGVNVVLNGFGDAAGIARIRRDLEQSFGIST 69 Query: 75 LQ--ADVSKQQDLQAMARRAVELHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDG 132 + AD+S D++ MA A + G++D+L+N AG+ W AI+L Sbjct: 70 IYSAADMSMPADIEGMAEAARQTFGKVDILINNAGIQHVEAVETFPPAKWDAIIAINLSA 129 Query: 133 AWYGCKAVLPQMIEQGVGSIINIASVHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKG 192 A++ +AV P+M + G IINIAS H+ P Y AKHG+ GLT+++ +E A G Sbjct: 130 AFHAIRAVAPEMKARKWGRIINIASAHALVASPFKSAYVAAKHGVAGLTKSVALEMAEHG 189 Query: 193 VRVNAIAPGYIETQL------NVDYWNGFADPHAERQRALDLHPPRRVGQPIEVAMTAVF 246 V VNAI PGY+ T L G + R L P R+ ++ +F Sbjct: 190 VTVNAICPGYVLTPLVQKQIPETAKARGLTEEQVVRDVLLHAQPTRQFVTTEQIGALTLF 249 Query: 247 LASDEAPFINASCITIDGG 265 L + I + + IDGG Sbjct: 250 LCTAAGASITGAALPIDGG 268 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 272 Length adjustment: 25 Effective length of query: 247 Effective length of database: 247 Effective search space: 61009 Effective search space used: 61009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory