Align high affinity cationic amino acid transporter 1 (characterized)
to candidate WP_036259385.1 DL86_RS06255 amino acid permease
Query= CharProtDB::CH_091324 (622 letters) >NCBI__GCF_000746085.1:WP_036259385.1 Length = 498 Score = 267 bits (683), Expect = 7e-76 Identities = 151/412 (36%), Positives = 234/412 (56%), Gaps = 20/412 (4%) Query: 24 EESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLC 83 E + L R L+ ++ALG+G +GAG++VL G A AGPA+ +SF++A + AGLC Sbjct: 27 ETAGLHRTLSLASVIALGIGCIIGAGIFVLTGHAAASYAGPAVSLSFVLAGIVCAFAGLC 86 Query: 84 YGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSA-------TF 136 Y E + VP GSAY Y+Y T+GE A+I GW+LIL Y G ++VA WS F Sbjct: 87 YAEMASTVPVAGSAYTYAYATMGEFIAWIIGWDLILEYAFGATTVAIGWSGYVTSFLKDF 146 Query: 137 DELIGKPIGEFSRQHMALN----APGVLAQTPDIFAVIIIIILTGLLTLGVKESAMVNKI 192 D I + + N + G L P A II++LT LL +G++ESA VN Sbjct: 147 DITIPAALASAPLAYDPANGDWTSTGALFNIP---AAFIIVLLTVLLVVGIRESARVNNA 203 Query: 193 FTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGA 252 I + ++ +V+G S NW +T N S N+ G+ +G+SG++ GA Sbjct: 204 IVLIKLAIILLFIVAGVSSISAANW-VTSTNPSGAFIPPNLGPGQ-----YGWSGIIRGA 257 Query: 253 ATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDI 312 A F+A++GFD ++T +E KNPQ+ +P+GI+ SL IC + Y V +T ++P+ L++ Sbjct: 258 AVVFFAYIGFDAVSTAAQEAKNPQRDMPLGILGSLAICTVLYVLVGVVITGVVPFDKLNV 317 Query: 313 DSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKIN 372 P+ G + + G++ LS+ +L + PR+ Y+MA DGLL F A ++ Sbjct: 318 PDPIALGVDAIGLGWLSFLIKFGAILGLSSVILVLLLGQPRIFYSMARDGLLPPFAAMVH 377 Query: 373 NRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLR 424 R +TP + T+ +GAI A+++ L + + +L+SIGTL A+++V VLVLR Sbjct: 378 PRFRTPYVTTILTGAIVAILSGLLPIGLVGELVSIGTLFAFTVVCLGVLVLR 429 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 828 Number of extensions: 50 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 622 Length of database: 498 Length adjustment: 36 Effective length of query: 586 Effective length of database: 462 Effective search space: 270732 Effective search space used: 270732 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory