Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate WP_036257684.1 DL86_RS02605 SDR family oxidoreductase
Query= SwissProt::Q92RN6 (256 letters) >NCBI__GCF_000746085.1:WP_036257684.1 Length = 2024 Score = 112 bits (280), Expect = 6e-29 Identities = 85/244 (34%), Positives = 121/244 (49%), Gaps = 10/244 (4%) Query: 16 VLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQT---GQAPHFIQADL 72 VLVTGG +G A+ FA +GA V + SL ++ AA+ G I+A + Sbjct: 11 VLVTGGAKNVGKAIAMRFAERGAHVI---VNFFHSLEASKETAAELRAMGVEVDVIRASV 67 Query: 73 RNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLSVNLRHLFFMCQA 132 V DE AK G + +LVNNAA ++ + EE +D++LS NL+ F+ + Sbjct: 68 AQKNQVDRMFDEIAAKYGRLDILVNNAASGALLCVDDIAEEHFDKALSTNLKGAFWCSRR 127 Query: 133 VAPHMQRQGGGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGPDNIRVNAIL 192 A M R GG+IVN SS+ L T+KA + LT+ LA + P IRVN Sbjct: 128 AASLMGR--GGAIVNVSSVGATLVPANYLVVGTSKAALESLTRYLAVEYAPRGIRVNT-A 184 Query: 193 PGMIVTERQRRLWLTEESIARMQ-ERQCLKRMLVADDLVGPCLFLASDSSAAMTAQAMII 251 ++ ++ ES R LKR+ A+DL LFLASDSS +T Q ++ Sbjct: 185 SATLIDGSVAEMFPNSESTKRSSIAATPLKRLAAAEDLADLVLFLASDSSRWITGQVVVA 244 Query: 252 DGGV 255 DGG+ Sbjct: 245 DGGL 248 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 936 Number of extensions: 41 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 2024 Length adjustment: 39 Effective length of query: 217 Effective length of database: 1985 Effective search space: 430745 Effective search space used: 430745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory