Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate WP_036263857.1 DL86_RS15400 enoyl-CoA hydratase/isomerase family protein
Query= SwissProt::Q0AVM1 (260 letters) >NCBI__GCF_000746085.1:WP_036263857.1 Length = 259 Score = 137 bits (345), Expect = 2e-37 Identities = 85/253 (33%), Positives = 129/253 (50%), Gaps = 6/253 (2%) Query: 4 ENIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSFV 63 E+++ + E +A + NRP+ NAL + V+ DPA+++LI+TG+GD++F Sbjct: 3 EDLLFKVEAGIAQVVFNRPRTRNALTSGMYEGLAAICAKVDADPAIKVLILTGAGDQAFA 62 Query: 64 AGADIA-FMQNLSAMEAREFGALGQKVFRLIEAMEKPVIAAVNGFALGGGCELAMCCDFR 122 +G DIA F Q S + + A + +E IAA+ G GGG +A CCD R Sbjct: 63 SGTDIAEFRQFASPDDVLAYEARIEAALSALERCRASTIAAIAGVCTGGGAMIAACCDLR 122 Query: 123 IAASNAKFGQPEV-GLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINADEAFRIGLVNK 181 I K G P LG RL L+GP K L+ TA ++ A EA +GL+N+ Sbjct: 123 IGEPETKLGMPIARTLGNCLSMSNYARLAGLIGPARVKDLILTARLVGAKEAIAMGLLNE 182 Query: 182 VV-QPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIEADAFGLCFATQ 240 V Q +ELLP + R+ L++R +K A ++ S D +C+ ++ Sbjct: 183 AVDQTKELLPRAHDLGRRVAGHAPLSLRATKEAL---LRMRGQAPQSAAEDLVLMCYLSE 239 Query: 241 DQKEGMTAFLEKR 253 D +EG+ AFLEKR Sbjct: 240 DFREGVAAFLEKR 252 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 259 Length adjustment: 24 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory