Align Glycerol uptake facilitator protein 4; D/L-lactic acid transporter; Lactic acid channel (characterized)
to candidate WP_017752629.1 PN53_RS13245 MIP/aquaporin family protein
Query= SwissProt::F9UMX3 (238 letters) >NCBI__GCF_000816635.1:WP_017752629.1 Length = 234 Score = 173 bits (438), Expect = 3e-48 Identities = 94/236 (39%), Positives = 132/236 (55%), Gaps = 8/236 (3%) Query: 4 QLLAEFMGTALMIIFGVGVHCSEVLKGTKYRGSGHIFAITTWGFGITIALFIFGNVC--- 60 +L+AEF+GT +++ G GV + L +K + G + W F + I +FG+V Sbjct: 3 KLIAEFVGTMILVYLGDGVCANCTLTKSKGQNGGWMVITAGWAFAVGIPALMFGSVSGAH 62 Query: 61 INPAMVLAQCILGNLSWSLFIPYSVAEVLGGVVGAVIVWIMYADHFAASADEISPITIRN 120 NPA+ + G + Y +A++LGG+VG +VWI Y H+ + D+ + + I Sbjct: 63 FNPALTIGLAAAGKFPAAEVPGYIIAQMLGGIVGGALVWITYLPHWEKTEDKAAKLGI-- 120 Query: 121 LFSTAPAVRNLPRNFFVEFFDTFIFISGILAISEVKTP-GIVPIGVGLLVWAIGMGLGGP 179 F TAPA+RNLP NF EF T + + IL + T GI + V L+W+IG+ LGGP Sbjct: 121 -FCTAPAIRNLPSNFLTEFLGTALLVFAILGMGAQHTALGIGTLFVVFLIWSIGLSLGGP 179 Query: 180 TGFAMNLARDMGPRIAHAILPIKNKADSDWQYGIIVPGIAPFVGAACAALFMHGFF 235 TG+A+N ARD+ PRIAHAILPI K SDW Y I P P G C AL + F Sbjct: 180 TGYAINPARDLAPRIAHAILPIAGKGGSDWSYSWI-PVFGPIAGGICGALLFNVIF 234 Lambda K H 0.330 0.146 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 234 Length adjustment: 23 Effective length of query: 215 Effective length of database: 211 Effective search space: 45365 Effective search space used: 45365 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory