Align Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 (characterized)
to candidate WP_195510357.1 PN53_RS09000 class II aldolase
Query= SwissProt::P13243 (285 letters) >NCBI__GCF_000816635.1:WP_195510357.1 Length = 281 Score = 191 bits (485), Expect = 2e-53 Identities = 112/285 (39%), Positives = 161/285 (56%), Gaps = 4/285 (1%) Query: 1 MPLVSMTEMLNTAKEKGYAVGQFNLNNLEFTQAILQAAEEEKSPVILGVSEGAGRYMGGF 60 M L + E+L+ A+++ YA+G F++ N+E ++AAEE KSP+IL ++E ++ Sbjct: 1 MSLTRLKELLDEAEDRKYAIGAFSIANMEMIIGAVKAAEELKSPIILQIAESRLKHSPLH 60 Query: 61 KTVVAMVKALMEEYKVTVPVAIHLDHGSSFESCAKAIHAGFTSVMIDASHHPFEENVATT 120 M++A K VPVA+HLDHG + + +A+ GFTSVMID S + ++N+ T Sbjct: 61 LIGPVMMEAAK---KAKVPVAVHLDHGLTMDCIHEALDLGFTSVMIDGSKYTLDKNIDLT 117 Query: 121 AKVVELAHFHGVSVEAELGTVGGQEDDVIAEGVIYADPKECQELVERTGIDCLAPALGSV 180 V++ A +G SVEAE+G VGG ED +Y D E E T +D LA +G+ Sbjct: 118 KSVIKKAQEYGASVEAEIGRVGGSEDGSEDISAMYTDTGEAYEFYSETKVDALAIGIGNA 177 Query: 181 HGPYKGEPNLGFKEMEEIGKSTGLPLVLHGGTGIPTADIKKSISLGTAKINVNTENQISS 240 HG YKG PNL F ++ I K +PLVLHGG+GI D +K +S G KIN+ T IS Sbjct: 178 HGVYKGLPNLNFDVLKNIYKKVDVPLVLHGGSGISDDDFRKCVSYGVRKINIATATFISV 237 Query: 241 AKAVRETLAAKPDEYDPRKYLGPAREAIKETVIGKMREFGSSNQA 285 A+ V E L K + D K E V ++ FGS+N+A Sbjct: 238 AQKVEE-LCRKHEHTDYFKLHEAEIEGAYLNVKKHIKIFGSNNKA 281 Lambda K H 0.313 0.131 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 281 Length adjustment: 26 Effective length of query: 259 Effective length of database: 255 Effective search space: 66045 Effective search space used: 66045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory