Align Glucose/fructose:H+ symporter, GlcP (characterized)
to candidate WP_039652874.1 PN53_RS08915 sugar porter family MFS transporter
Query= TCDB::P15729 (468 letters) >NCBI__GCF_000816635.1:WP_039652874.1 Length = 455 Score = 257 bits (657), Expect = 5e-73 Identities = 151/452 (33%), Positives = 243/452 (53%), Gaps = 24/452 (5%) Query: 19 LISGVAALGGFLFGFDTAVINGAVAALQKHFQTDSLLTGLSVSLALLGSALGAFGAGPIA 78 LI A GGF+FG+D +INGA+ ++ + LL G S +G+ +GA +A Sbjct: 9 LIYFFGAFGGFMFGYDIGIINGALPGIKTTWGISPLLEGWITSGLFVGAMIGASLMASLA 68 Query: 79 DRHGRIKTMILAAVLFTLSSIGSGLPFTIWDFIFWRVLGGIGVGAASVIAPAYIAEVSPA 138 DR GR + ++ +A++F + ++GS + IF R++ G+ VG AS + P Y+ E+SPA Sbjct: 69 DRFGRRRMIMWSAIVFVIGALGSAFSTSTSFLIFARIILGVAVGGASALVPMYMGEISPA 128 Query: 139 HLRGRLGSLQQLAIVSGIFIALLSNW-FIALMAGGSAQNPWLFGAAAWRWMFWTELIPAL 197 RG+L L QL I G+ IA N+ F+ + G WRWM ++PAL Sbjct: 129 EERGKLSGLNQLMITIGMLIAYGINYAFVHVFEG-------------WRWMLGGAMVPAL 175 Query: 198 LYGVCAFLIPESPRYLVAQGQGEKAAAILWKVEGG-DVPSRIEEIQATVSLDHKPRFSDL 256 + F++PESPR+LV G+ E A +L + + S +EI + D F DL Sbjct: 176 VLLFGTFILPESPRFLVRIGKNELARKVLQSMRSSKEAESEYQEIINSKYSD-SGSFKDL 234 Query: 257 LSRRGGLLPIVWIGMGLSALQQFVGINVIFYYSSVLWRSVGFTEEKSLLITVITGFINIL 316 ++ LP V G GL+ LQQ G N IFYYSS + V ++ ++ TV G + +L Sbjct: 235 FGKKA--LPAVVAGCGLTLLQQIQGANTIFYYSSQILAKVFGSDIGGVISTVGIGVVFVL 292 Query: 317 TTLVAIAFVDKFGRKPLLLMGSIGMTITLGILSVVFGGATVVNGQPTLTGAAGIIALVTA 376 T+V + VD+F R+ L + GSIGM ++L ++ +++ A + T + Sbjct: 293 ATVVTLMIVDRFKRRSLFMSGSIGMGVSLLLVGLIYPYAQANHAWAMWT------VFILI 346 Query: 377 NLYVFSFGFSWGPIVWVLLGEMFNNKIRAAALSVAAGVQWIANFIISTTFPPLLDTVGLG 436 +YV + +SW + W+++GE+F +++R A +A+ V W N +++ FP LL+TVGL Sbjct: 347 CVYVIFYAYSWAAVTWIVVGELFPSQVRGIATGIASTVNWFGNILVALFFPVLLETVGLS 406 Query: 437 PAYGLYATSAAISIFFIWFFVKETKGKTLEQM 468 + +A + F F + ETKGK+LE++ Sbjct: 407 MIFFGFAAICILGFLFAKFVLYETKGKSLEEI 438 Lambda K H 0.325 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 591 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 455 Length adjustment: 33 Effective length of query: 435 Effective length of database: 422 Effective search space: 183570 Effective search space used: 183570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory