Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_017751970.1 PN53_RS03170 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000816635.1:WP_017751970.1 Length = 373 Score = 208 bits (530), Expect = 2e-58 Identities = 115/295 (38%), Positives = 183/295 (62%), Gaps = 20/295 (6%) Query: 6 VKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD 65 +KNVSK F +V L +N++I GE +LG SG GKTT +RIIAG ++P+ G + Sbjct: 12 IKNVSKYFGDNQV--LKKINLDIYKGEFLTLLGSSGCGKTTTLRIIAGFEIPTEGSV--- 66 Query: 66 DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVA 125 ++A+ + P +R + VFQ++AL+P++ F+NIAF L K+ K EI+K+VEE+ Sbjct: 67 --VIANKDATNLQPYNRDVNTVFQSYALFPHMNVFDNIAFGLVEKKIKKSEIKKKVEEIL 124 Query: 126 KILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKE 185 +++ +++ P E+SGGQ+QRVA+ARAL+ +P +LLLDEP + LD ++R + +K Sbjct: 125 ELVQLNNFEKRKPSEMSGGQKQRVAIARALINNPKVLLLDEPLAALDLKLRKQMQLELKH 184 Query: 186 VQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEIN 245 +Q +LGVT + V+HD + ++DR+GV+ KG L Q+G P+++Y+ P + VA IGE N Sbjct: 185 LQQQLGVTFVYVTHDQEEALTMSDRIGVMNKGILEQIGTPKEIYEQPKTKFVADFIGESN 244 Query: 246 ELEGKVTNEGVVIGSLRFPVSVSSDRAI-----------IGIRPEDVKLSKDVIK 289 E V+ + + +L + S AI I +R E +KLSK+ I+ Sbjct: 245 IFEATVSKK--IGKNLELVIEDGSVSAIGNEFKKNEIVSISVRLEHMKLSKEPIE 297 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 373 Length adjustment: 29 Effective length of query: 324 Effective length of database: 344 Effective search space: 111456 Effective search space used: 111456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory